| Protein: 66556661 XP_623921.1 PREDICTED: adenylate kinase 2 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.7 | 38.1 | 31.2 | 0.98397434 | 1.2211539 |
| Scape | 31.1 | 33.1 | 35.7 | 0.87114847 | 0.9271709 |
| Brain | 51.9 | 48.1 | 1.079002 | ||
| Crop | 29.9 | 40 | 30.1 | 0.99335545 | 1.3289037 |
| Eye | 81.4 | 18.6 | 4.376344 | ||
| Intestine | 20.1 | 39.8 | 40.1 | 0.50124687 | 0.9925187 |
| Leg, front | 29.9 | 38.8 | 31.2 | 0.9583333 | 1.2435898 |
| Leg, middle | 27.3 | 41.8 | 30.9 | 0.88349515 | 1.3527508 |
| Leg, rear | 32.7 | 39.1 | 28.2 | 1.1595745 | 1.3865248 |
| Mandibular gland | 11.2 | 88.8 | 0.12612613 | ||
| Rectum | 4.6 | 58.7 | 36.8 | 0.125 | 1.5951087 |
| Salivary gland, cerebral | 56 | 17 | 27 | 2.074074 | 0.6296296 |
| Salivary gland, thoracic | 26 | 39.9 | 34.1 | 0.76246333 | 1.1700879 |
| Sternite | 27.7 | 34 | 38.2 | 0.7251309 | 0.8900524 |
| Tergite | 43.2 | 39.2 | 17.6 | 2.4545455 | 2.2272727 |
| Ventriculus | 1.5* | 33.7 | 64.8 | 0.023148147 | 0.52006173 |
| Thoracic muscle | 9.1 | 80.5 | 10.4 | 0.875 | 7.7403846 |
| Fat body | 34.2 | 48.5 | 17.3 | 1.9768786 | 2.8034682 |
| Malpighian tubules | 31.5 | 36 | 32.5 | 0.9692308 | 1.1076924 |
| Nerve chord | 23.6 | 40.4 | 36 | 0.65555555 | 1.1222222 |
| Poison sac | |||||
| Sting | 57.6 | 42.4 | 1.3584906 | ||
| Heart | 34.1 | 28.5 | 37.4 | 0.9117647 | 0.7620321 |
| Hypopharyngeal gland | 90.1 | 9.9 | 9.10101 | ||
| Galea | 19.4 | 40.1 | 40.5 | 0.47901234 | 0.99012345 |
| Glossa | 35 | 30.3 | 34.6 | 1.0115607 | 0.8757225 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.1 | 43.3 | 34.5 | 0.84347826 | 1.2550725 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAPRVETISKEILEFPKDIPKNGINAVLLGPPGSGKGTQAPLLKERYCVCHLSTGDMLRA EINSGSALGAEIKKIIDEGKLVSDDLVVNMIDHNLNKPECKRGFLLDGFPRSVPQAEKLD QMLKKRQTKLDAVIEFGIDDNLLIKRITGRLIHPTSGRSYHEEFAPPKEYMKDDITGEPL IRRSDDNVEALKKRLCTYHTETEPLIDYYALQGIHYYVNAARSSKDVFKDIDCIFLKATK QQEKKGFFSRFF |
 Top
| |