| Protein: 58585154 NP_001011607.1 melittin precursor |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 15* | 85 | 0.1764706 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 6.9 | 3.7 | 89.3 | 0.07726764 | 0.04143337 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 0.5* | 0.2* | 99.3 | 0.005035247 | 0.002014099 |
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | 13.5 | 86.5 | 0.15606937 | ||
| Sting | 0.1* | 99.9 | 0.001001001 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 39.2 | 60.8 | 0.6447368 | ||
| Glossa | 66.6 | 33.4 | 1.994012 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 7.5 | 20.6 | 79.2 | 0.09469697 | 0.26010102 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKFLVNVALVFMVVYISYIYAAPEPEPAPEPEAEADAEADPEAGIGAVLKVLTTGLPALI SWIKRKRQQG |
 Top
| |