| Protein: 328784556 XP_392696.4 PREDICTED: esterase FE4-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.5 | 27.7 | 26.8 | 1.6977612 | 1.0335821 |
| Scape | 36.7 | 27 | 36.3 | 1.0110192 | 0.74380165 |
| Brain | |||||
| Crop | 27.7 | 15.8 | 56.5 | 0.4902655 | 0.279646 |
| Eye | |||||
| Intestine | 44.7 | 28.5 | 26.8 | 1.6679105 | 1.0634328 |
| Leg, front | 47.3 | 11.3* | 41.3 | 1.1452785 | 0.27360776 |
| Leg, middle | 47.4 | 9* | 43.6 | 1.0871559 | 0.20642202 |
| Leg, rear | 51.6 | 6.9* | 41.4 | 1.2463768 | 0.16666667 |
| Mandibular gland | 54.3 | 45.7 | 1.1881838 | ||
| Rectum | 16.2 | 59.9 | 23.9 | 0.67782426 | 2.5062761 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 31.8 | 34.7 | 33.5 | 0.94925374 | 1.0358208 |
| Sternite | 33.8 | 28.4 | 37.9 | 0.8918206 | 0.74934036 |
| Tergite | 29.5 | 36 | 34.5 | 0.85507244 | 1.0434783 |
| Ventriculus | 12.6 | 39.3 | 48.1 | 0.26195425 | 0.81704783 |
| Thoracic muscle | |||||
| Fat body | 60 | 1.3* | 38.6 | 1.5544041 | 0.033678755 |
| Malpighian tubules | 43.6 | 31 | 25.4 | 1.7165354 | 1.2204725 |
| Nerve chord | 36.6 | 43.3 | 20.1 | 1.8208956 | 2.154229 |
| Poison sac | |||||
| Sting | 12.4 | 87.6 | 0.14155251 | ||
| Heart | 18.2 | 8.4* | 73.5 | 0.24761905 | 0.11428571 |
| Hypopharyngeal gland | |||||
| Galea | 22.2 | 11.8* | 66 | 0.33636364 | 0.17878787 |
| Glossa | 31.1 | 31.6 | 37.3 | 0.83378017 | 0.847185 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.4 | 24.4 | 42.2 | 0.86255926 | 0.578199 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASENTIVRVKQGELRGVVEETDYGDQYLAFRGIPYAKPPIGPLRFKDPEPLEPWSGIRD ASKHGDVCAQNDTLFRQLKGSDDCLYLNVYRPVAESKTKRAVMVWIHGGAFMVGSGNDDI YGPDYLMRKDIVLVKINYRLGVLGFLNLEHEIAPGNQGLKDQVMALKWVQENISSFGGDP NNVTIFGESAGGGSVHYLTISPLAQGLFHKAIAQSGVAINPWAIITKEPSKYAYELAAKL GEKSTDPKTVLEFLRTVDAQKLAFTETQILKTNQPYVTFGTFAPCIDNKSPNPFMPRHPS EMMKTGIKVPLLIGYNENEGSSVINFLFQHVESEDVMQNVNENFEIVIPLELQPYLKKQS ITPNDLKHYYFGKEIISEETKQKYADFMSDVMFLRGIHDVINIQMEKAAESTYMYKFTYD SEMSLLRMVMNVTLPGATHADELQYLFFPDLSKKLANRKLLEVGTDMYIIMEYFTQMWTD FAKTGNPTPKVTDLIRTIWKPLQKTDTYNYLRIDKTLKMESYSKSGQRFDWNRIKNKL |
 Top
| |