| Protein: 328787095 XP_003250885.1 PREDICTED: ubiquitin-conjugating enzyme E2 L3-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.6 | 26.6 | 23.8 | 2.0840337 | 1.117647 |
| Scape | 38.8 | 27.5 | 33.7 | 1.1513354 | 0.81602377 |
| Brain | |||||
| Crop | 54.3 | 45.7 | 1.1881838 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 29.8 | 70.2 | 0.42450142 | ||
| Mandibular gland | 22.9 | 77.1 | 0.29701686 | ||
| Rectum | |||||
| Salivary gland, cerebral | 15.6 | 84.4 | 0.18483412 | ||
| Salivary gland, thoracic | 36.7 | 30.6 | 32.7 | 1.1223241 | 0.9357798 |
| Sternite | 56 | 44 | 1.2727273 | ||
| Tergite | 83 | 17 | 4.882353 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 45.4 | 35.7 | 18.9 | 2.4021163 | 1.8888888 |
| Malpighian tubules | 25.6 | 47.6 | 26.8 | 0.95522386 | 1.7761194 |
| Nerve chord | 43.1 | 38 | 18.9 | 2.2804232 | 2.010582 |
| Poison sac | |||||
| Sting | |||||
| Heart | 45.3 | 26.8 | 27.9 | 1.6236559 | 0.9605735 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 34.3 | 65.7 | 0.52207 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.3 | 35.9 | 41.9 | 0.98568016 | 0.8568019 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAATRRLQKELGDLRASAMKNFTNIQVDESNILTWQGLILPDNPPYNKGAFRIEINFPAE YPFKPPKINFKTKIYHPNVDEKGQVCLPIISAENWKPATKTDQVVQALIALVNDPEPEHP LRADLAEEFLKDRKKFLKNAEEFTKKHAEKRRESSSNE |
 Top
| |