| Protein: 328783910 XP_623566.2 PREDICTED: succinate dehydrogenase [ubiquinone] iron-sulfur subunit mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36 | 29.7 | 34.2 | 1.0526316 | 0.8684211 |
| Scape | 40.3 | 29.7 | 30 | 1.3433334 | 0.99 |
| Brain | 45.9 | 54.1 | 0.84842885 | ||
| Crop | 28.7 | 44.4 | 26.9 | 1.0669144 | 1.6505576 |
| Eye | 45 | 55 | 0.8181818 | ||
| Intestine | 26.1 | 31.1 | 42.8 | 0.6098131 | 0.7266355 |
| Leg, front | 31.5 | 29.4 | 39 | 0.8076923 | 0.75384617 |
| Leg, middle | 32.2 | 29 | 38.8 | 0.8298969 | 0.7474227 |
| Leg, rear | 21.5 | 30.4 | 48.1 | 0.44698545 | 0.63201666 |
| Mandibular gland | 76.8 | 23.2 | 3.310345 | ||
| Rectum | 40.6 | 30.3 | 29.1 | 1.395189 | 1.0412371 |
| Salivary gland, cerebral | 29.9 | 22.8 | 47.2 | 0.6334746 | 0.48305085 |
| Salivary gland, thoracic | 24.3 | 45.5 | 30.2 | 0.80463576 | 1.5066226 |
| Sternite | 23.2 | 33.3 | 43.6 | 0.5321101 | 0.76376146 |
| Tergite | 25.2 | 34.7 | 40.1 | 0.62842894 | 0.86533666 |
| Ventriculus | |||||
| Thoracic muscle | 31.1 | 47.7 | 21.2 | 1.4669812 | 2.25 |
| Fat body | 28.8 | 46 | 25.2 | 1.1428572 | 1.8253968 |
| Malpighian tubules | 32.2 | 31 | 36.7 | 0.8773842 | 0.8446866 |
| Nerve chord | 34.1 | 22.7 | 43.2 | 0.7893519 | 0.525463 |
| Poison sac | |||||
| Sting | 37 | 63 | 0.5873016 | ||
| Heart | 52.9 | 15 | 32.1 | 1.6479751 | 0.46728972 |
| Hypopharyngeal gland | 84.1 | 15.9 | 5.289308 | ||
| Galea | 67.2* | 15.8 | 17.1 | 3.9298246 | 0.9239766 |
| Glossa | 77.9* | 10.4 | 11.7 | 6.6581197 | 0.8888889 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38 | 34.4 | 35.3 | 1.0764873 | 0.97450423 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAGIAPQACRNVFRQVRGFHISANQNASEAKLKSFAVYRWNPDKPDEKPYMQEYKVDLNT CGPMVLDALIKIKNEIDPTLTFRRSCREGICGSCAMNIGGTNTLACISKIDTNLNSTSKI YPLPHMYIVKDLVPDLNNFYNQYKSIQPWLQRGDAKETGAKQYLQSVEDRKKLDGLYECI LCACCSTSCPSYWWNGDKYLGPAVLMQAYRWIIDSRDSKAKERLAKLRDPYSVYRCHTIM NCTRTCPKT |
 Top
| |