| Protein: 328777435 XP_395275.3 PREDICTED: proline dehydrogenase 1 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 24 | 32.8 | 43.2 | 0.5555556 | 0.7592593 |
| Scape | 38.1 | 24.9 | 37 | 1.0297297 | 0.672973 |
| Brain | 56.7 | 43.3 | 1.3094689 | ||
| Crop | 25.6 | 37.2 | 37.2 | 0.68817204 | 1 |
| Eye | |||||
| Intestine | 25.9 | 27.2 | 46.9 | 0.5522388 | 0.57995737 |
| Leg, front | 28.7 | 35.1 | 36.2 | 0.79281765 | 0.96961325 |
| Leg, middle | 19.1 | 59.6 | 21.3 | 0.8967136 | 2.7981222 |
| Leg, rear | 50.4 | 49.6 | 1.016129 | ||
| Mandibular gland | 58.6 | 41.4 | 1.4154589 | ||
| Rectum | |||||
| Salivary gland, cerebral | 5.3* | 13.3 | 81.4 | 0.065110564 | 0.16339067 |
| Salivary gland, thoracic | 61.7* | 16 | 22.3 | 2.7668161 | 0.71748877 |
| Sternite | 36.3 | 34.9 | 28.8 | 1.2604166 | 1.2118056 |
| Tergite | 68.6 | 31.4 | 2.1847134 | ||
| Ventriculus | |||||
| Thoracic muscle | 74.8 | 25.2 | 2.9682539 | ||
| Fat body | 84.1* | 9 | 6.9 | 12.188406 | 1.3043479 |
| Malpighian tubules | 97.3* | 2.7 | 36.037037 | ||
| Nerve chord | 24.8 | 34.5 | 40.7 | 0.6093366 | 0.84766585 |
| Poison sac | |||||
| Sting | 52 | 48 | 1.0833334 | ||
| Heart | 51.8 | 17 | 31.3 | 1.654952 | 0.543131 |
| Hypopharyngeal gland | 82.5 | 17.5 | 4.714286 | ||
| Galea | 31.6 | 11.9* | 56.6 | 0.5583039 | 0.21024735 |
| Glossa | 62.8 | 12.1 | 25 | 2.512 | 0.484 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.5 | 33.7 | 35.2 | 1.2926136 | 0.9573864 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKFAKQILGEKLFTKLMRASFYGHFVAGEDELQITPVLDRLRQFGVKPILDYSVEEDISQ EEAERREMQGSVSEAGDEKREGPLKKYHVAKPFADRRYKVSSARTYFYLNEANCERNMDI FIRCLESVAGASMGVGFTAVKLTALGRPQLLLQLSEVIMRARQYMSDVVGGEGAVLTHHA KPDDFMKKFEEAHIKDEETVQKFLQKIQSDKEGVIHLFPWSGILDENYELSETFQVPDIK TGKMVRLMSQLTSKEEEMFRNMIRRLNNIVTVADKLDVRIMIDAEQTYFQPAISRLTLEM MRKYNTRKAVVFNTYQTYLQDAFNEVKTDLEQAERQNFYFGAKLVRGAYIEQERARAAAM GYPDPTNPTYEATTDSYHRTLMECLRRMKQYKDKGEDPKKIGIMVASHNEDTVRFAIEKM KEIGISPEDKVICFGQLLGMCDYITFPLGQSGYSAYKYIPYGPVKEVLPYLSRRAQENRG ILKKIKKEKRLLLTEILRRFASGQIFYKPKGNYTPV |
 Top
| |