| Protein: 58585212 NP_001011635.1 yellow-f |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.1 | 73.9 | 0.35317996 | ||
| Scape | 18 | 55.7 | 26.2 | 0.6870229 | 2.1259542 |
| Brain | 44.7 | 55.3 | 0.80831826 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 37.4 | 27.8 | 34.8 | 1.0747126 | 0.7988506 |
| Leg, middle | 51.4 | 48.6 | 1.0576131 | ||
| Leg, rear | |||||
| Mandibular gland | 16.6 | 83.4 | 0.19904077 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 49.1 | 50.9 | 0.96463656 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 40.1 | 34.4 | 25.6 | 1.5664062 | 1.34375 |
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 26.3 | 46.5 | 27.1 | 0.9704797 | 1.7158672 |
| Glossa | 11.8 | 54.5 | 33.7 | 0.35014838 | 1.6172106 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.5 | 44.7 | 45.9 | 0.62091506 | 0.9738562 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MWHFLWIVFLALANGEEIKTIYSWNVIEYNFPNDNIRNTLISNGDYIEENNMPNGMQIWN DKVFITIPRWKNGVPSNLNFFLKNDESESPKLNPYPNWEMNDINKIDSIINIIRVRVDAC DRLWGVDTGVDDILGNNTVIHQPRIIIIDLKTDKILRIYPLKSSDQTSDSFFVDLVIDVD PNNCDNTYAYISDLSGYALVVYSWAKNDSWRITHNFFYFDPRYGNYNINGFNFQWKDGLF GLSLSALQTDGYKILYFHAMSSIAEFSVSTEVLQDHTLEKSNDYYAFHFEGEKGPNSQGP SSVIDTNTGVDYFTQINRNGIACWDTNTELNPNTFILVAENNTTMVFCNDLSIDRSTNTM YVLSDNFQQLLFSKYDAKKRNFFITMFDLDFLTNACKKKDDKPKRRLPHIL |
 Top
| |