| Protein: 66513934 XP_394381.2 PREDICTED: sodium/potassium-transporting ATPase subunit beta-2 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.3 | 30.3 | 39.4 | 0.7690355 | 0.7690355 |
| Scape | 48 | 19 | 33 | 1.4545455 | 0.57575756 |
| Brain | 32.9 | 67.1 | 0.49031296 | ||
| Crop | 55.2 | 44.8 | 1.2321428 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 35.6 | 29.2 | 35.3 | 1.0084985 | 0.82719547 |
| Leg, middle | |||||
| Leg, rear | 31.9 | 34.7 | 33.3 | 0.957958 | 1.042042 |
| Mandibular gland | 12.3 | 87.7 | 0.14025086 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 81.9* | 5.3 | 12.8 | 6.3984375 | 0.4140625 |
| Sternite | 5.6* | 94.4 | 0.059322033 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 22.3 | 14.4 | 63.3 | 0.3522907 | 0.22748815 |
| Malpighian tubules | |||||
| Nerve chord | 16.5 | 52.7 | 30.9 | 0.5339806 | 1.7055017 |
| Poison sac | |||||
| Sting | |||||
| Heart | 3.5 | 30 | 66.6 | 0.052552555 | 0.45045045 |
| Hypopharyngeal gland | 89.9 | 10.1 | 8.9009905 | ||
| Galea | 31.7 | 68.3 | 0.46412885 | ||
| Glossa | 38.2 | 61.8 | 0.618123 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.7 | 31.8 | 49.9 | 0.6753507 | 0.63727456 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVSKDSKMVTPEMANPYLKPPSMSTSQSLKTFIYNRETGAFLGRTASSWGKIGLFYLIFY GVLAALVAICFWGFFQTLDPRIPRWQLERSIIGTNPGLGFRPQPPLENVESTLIWYRGTD SENFKYWIDSLESFLKDYITPGSIPGLGANINKCDYNQPPPPGKVCDVDVKNWYPCTKEN KYNYHKSAPCIFLKLNKIYGWKPEFYNDTNSLPQNMPIDLKEHITGLKNTYQLDTIWVSC EGENPADQENIGPIEYIPRRGFPGYFYPFENSEGYLSPLVAIHFVRPRTGILINVECKAW ARNIKHSRHDKMGVVHFELMID |
 Top
| |