| Protein: 58585252 NP_001011653.1 troponin C type IIa |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.5 | 67.5 | 0.4814815 | ||
| Scape | 59.9* | 24.3 | 15.8 | 3.7911391 | 1.5379747 |
| Brain | |||||
| Crop | 43 | 57 | 0.75438595 | ||
| Eye | 5 | 40.6 | 54.4 | 0.09191176 | 0.7463235 |
| Intestine | |||||
| Leg, front | 29.1 | 27.6 | 43.2 | 0.6736111 | 0.6388889 |
| Leg, middle | 27.8 | 34 | 38.2 | 0.7277487 | 0.8900524 |
| Leg, rear | 24.6 | 44.7 | 30.7 | 0.8013029 | 1.4560261 |
| Mandibular gland | 33.9 | 0.9* | 65.2 | 0.51993865 | 0.013803681 |
| Rectum | |||||
| Salivary gland, cerebral | 2.8* | 39.2 | 58 | 0.048275862 | 0.6758621 |
| Salivary gland, thoracic | 90* | 0.8* | 9.2 | 9.782609 | 0.08695652 |
| Sternite | 16.1 | 22.6 | 61.3 | 0.26264274 | 0.36867863 |
| Tergite | 3.1 | 25 | 71.9 | 0.043115437 | 0.34770516 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 74.6* | 22.6* | 2.8 | 26.642857 | 8.071428 |
| Malpighian tubules | 21.2* | 78.8 | 0.26903552 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 73.7* | 26.3 | 2.8022814 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 29.5 | 25.3 | 45.2 | 0.6526549 | 0.5597345 |
| Glossa | 26.8 | 30 | 43.2 | 0.6203704 | 0.6944444 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.5 | 29.6 | 45.2 | 0.71902657 | 0.65486723 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEDDQKMAVMRKAFQMFDTTKSGFIDTLKISTILNTMGQLFDDSDLNALISENDPEGTGK VNFDGFCRIAGRFLEEEDAEAMQEELKEAFRLYDREGNGYITTATLKEILAALDDKLTSA DLDGIIAEIDTDGSGTVDFDEFMEMMTGE |
 Top
| |