| Protein: 328778735 XP_623997.2 PREDICTED: ras-related protein Rab-11A |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40 | 30.3 | 29.8 | 1.3422819 | 1.0167785 |
| Scape | 61.2* | 20.6 | 18.1 | 3.3812156 | 1.1381216 |
| Brain | 36.3 | 17.3 | 46.4 | 0.7823276 | 0.37284482 |
| Crop | 38.2 | 31.5 | 30.3 | 1.2607261 | 1.039604 |
| Eye | 27.2 | 72.8 | 0.37362638 | ||
| Intestine | 27.3 | 42.9 | 29.9 | 0.9130435 | 1.4347826 |
| Leg, front | 35.1 | 35.6 | 29.3 | 1.1979523 | 1.2150171 |
| Leg, middle | 28.9 | 39.1 | 32 | 0.903125 | 1.221875 |
| Leg, rear | 43.1 | 26.9 | 30 | 1.4366666 | 0.89666665 |
| Mandibular gland | 6.7 | 78.7 | 14.5 | 0.46206897 | 5.427586 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 39 | 27 | 34 | 1.1470588 | 0.7941176 |
| Sternite | 23.6 | 44.8 | 31.6 | 0.7468355 | 1.4177215 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 28.5 | 50 | 21.5 | 1.3255814 | 2.3255813 |
| Malpighian tubules | 31.2 | 42.1 | 26.7 | 1.1685393 | 1.576779 |
| Nerve chord | 23.8 | 45 | 31.1 | 0.76527333 | 1.4469453 |
| Poison sac | |||||
| Sting | |||||
| Heart | 29.7 | 46.3 | 24 | 1.2375 | 1.9291667 |
| Hypopharyngeal gland | 54.4 | 45.6 | 1.1929824 | ||
| Galea | 39.1 | 27.2 | 33.7 | 1.1602374 | 0.80712163 |
| Glossa | 34.8 | 30.7 | 34.5 | 1.0086956 | 0.8898551 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33 | 38.4 | 32.4 | 1.0185186 | 1.1851852 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MYTEICIMQRCKDGTRNIKVPSVNLLKGFIAPDEMGTRDDEYDYLFKVVLIGDSGVGKSN LLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGQERYRAITSAYYRGAVG ALLVYDIAKHLTYENVERWLRELRDHADQNIVIMLVGNKSDLRHLRAVPTDEAKAFAEKN GLSFIETSALDSTNVETAFQNILTEIYRIVSQKQIRDPPEGDTIRPQNVEPIDVKPTMNS EGMRKQCCQ |
 Top
| |