| Protein: 62526114 NP_001014994.1 glycerol-3-phosphate dehydrogenase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.8 | 31.1 | 41 | 0.6780488 | 0.7585366 |
| Scape | 34.1 | 34.8 | 31.1 | 1.096463 | 1.1189711 |
| Brain | 34 | 66 | 0.5151515 | ||
| Crop | 44.7 | 23 | 32.3 | 1.3839009 | 0.7120743 |
| Eye | 59.8 | 40.2 | 1.4875622 | ||
| Intestine | 27.1 | 43.9 | 29 | 0.93448275 | 1.5137931 |
| Leg, front | 43.7 | 25.7 | 30.7 | 1.4234527 | 0.8371335 |
| Leg, middle | 43.8 | 28.2 | 28 | 1.5642858 | 1.0071429 |
| Leg, rear | 90* | 3.5 | 6.5 | 13.846154 | 0.53846157 |
| Mandibular gland | 78.1 | 21.9 | 3.56621 | ||
| Rectum | 69.4 | 30.6 | 2.267974 | ||
| Salivary gland, cerebral | 88.9 | 2 | 9.1 | 9.769231 | 0.21978022 |
| Salivary gland, thoracic | 42 | 22.3 | 35.6 | 1.1797752 | 0.62640446 |
| Sternite | 33 | 24.8 | 42.2 | 0.7819905 | 0.5876777 |
| Tergite | 22.8 | 22 | 55.2 | 0.41304347 | 0.39855072 |
| Ventriculus | 48.6 | 51.4 | 0.9455253 | ||
| Thoracic muscle | |||||
| Fat body | 21.4 | 10.3 | 68.3 | 0.31332356 | 0.15080526 |
| Malpighian tubules | 44 | 22.9 | 33 | 1.3333334 | 0.6939394 |
| Nerve chord | 11.5 | 55.2 | 33.3 | 0.34534535 | 1.6576576 |
| Poison sac | |||||
| Sting | 28.4 | 71.6 | 0.39664805 | ||
| Heart | 13.5 | 20.9 | 65.6 | 0.20579268 | 0.31859756 |
| Hypopharyngeal gland | 47.4 | 52.6 | 0.9011407 | ||
| Galea | 73.5* | 11.4 | 15.1 | 4.86755 | 0.7549669 |
| Glossa | 78.7* | 21.3 | 3.6948357 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 45.5 | 30.4 | 38 | 1.1973684 | 0.8 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAEKLRICIVGSGNWGSTIAKIIGINAANFSNFEDRVTMYVYEEIINGKKLTEIINETHE NVKYLPGHKLPPNIIAIPDVVEAAKDADILTFVVPHQFIKRICSALFGKIKPTAIGLSLI KGFDKKQGGGIELISHIISKQLHIPVSVLMGANLASEVANEMFCETTIGCKDKNMAPILK DLMETSYFKVVVVEDVDSVECCGALKNIVACGAGFIDGLGLGDNTKAAVMRLGLMEIIKF VNIFFPGGKKTTFFESCGVADLIATCYGGRNRKICEAFVKTGKKISELEKEMLNGQKLQG PFTAEEVNYMLKAKNMENRFPLFTTVHRICIGETMPMELIENLRNHPEYIDETRNYQECK CSI |
 Top
| |