![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 48095935 XP_394562.1 PREDICTED: probable maleylacetoacetate isomerase 2 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 14.8 | 53.6 | 31.6 | 0.46835443 | 1.6962025 |
| Brain | |||||
| Crop | 42.4 | 57.6 | 0.7361111 | ||
| Eye | |||||
| Intestine | 51.9 | 48.1 | 1.079002 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 55 | 45 | 1.2222222 | ||
| Mandibular gland | 47.6 | 52.4 | 0.90839696 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 29.8 | 31.3 | 38.9 | 0.76606685 | 0.80462724 |
| Sternite | 66.7 | 33.3 | 2.0030031 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.5 | 27 | 31.6 | 1.3132912 | 0.8544304 |
| Malpighian tubules | 26.3 | 42 | 31.6 | 0.8322785 | 1.329114 |
| Nerve chord | 19.9 | 54.8 | 25.3 | 0.78656125 | 2.166008 |
| Poison sac | |||||
| Sting | 58.6 | 41.4 | 1.4154589 | ||
| Heart | 10.4 | 43.8 | 45.8 | 0.22707424 | 0.95633185 |
| Hypopharyngeal gland | 59.6 | 40.4 | 1.4752475 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.2 | 48.9 | 40.2 | 0.6766169 | 1.2164179 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSVMGKPILYSYWRSSCSWRVRIALNLKEIPYDIKPVSLIKGGGEQHSNEFREINPMEQV PALHIDNHTLIESLNILQYLEETRPHRPLMPADPVKRARVREICEVIASGIQPLQNLVVL IYVGEERKKEWAQHWITRGLTAVEKLLSSSAGKYCVGDEITLADCCLIPQIFNARRFLVD LRPFPTILRVDRHLENHPAFTAAHPNNQPDCPPEATK |
|
| |