| Protein: 110750103 XP_001121584.1 PREDICTED: LIM and SH3 domain protein Lasp-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 46.7 | 53.3 | 0.8761726 | ||
| Scape | 60.5 | 39.5 | 1.5316455 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 39.5 | 24.8 | 35.6 | 1.1095506 | 0.6966292 |
| Leg, front | 55 | 45 | 1.2222222 | ||
| Leg, middle | 19 | 41.3 | 39.7 | 0.47858942 | 1.0403023 |
| Leg, rear | 50.1 | 49.9 | 1.004008 | ||
| Mandibular gland | 13.7 | 86.3 | 0.15874855 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 29.7 | 13.8 | 56.5 | 0.52566373 | 0.2442478 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 11.5 | 88.5 | 0.1299435 | ||
| Fat body | 42.4 | 57.6 | 0.7361111 | ||
| Malpighian tubules | 26 | 38.9 | 35.1 | 0.7407407 | 1.1082621 |
| Nerve chord | 0.5* | 99.5 | 0.005025126 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 47.9 | 20.8 | 31.3 | 1.5303514 | 0.6645367 |
| Hypopharyngeal gland | 76.4 | 23.6 | 3.2372882 | ||
| Galea | |||||
| Glossa | 31.9 | 68.1 | 0.4684288 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.3 | 38.7 | 54 | 0.59814817 | 0.71666664 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKTCARCEKTVYPIEELKCLDKIWHKQCFKCQGCGMILNMRTYKGFNKQPYCEAHIPKV KATTMAETPELKRIAENTKIQSNVKYHAEFEKAKGKFTQVADDPETLRIKQNSKIISNVA YHGELQKKAIMEQKRTMTGENGEQIEYVEYTDGTIAPASGVNANPPAARTASSPVQRTPG RIADYDPLSEARPSPYSARQAATTVIYTSDKGPVTNPPTRKIGSVADIDPVNEYYGSLTP ATNNNHVPQHQPPPPPPTNVGRVYRAMYDYEAQDLDEVSFCDGDLIVNCTAIDEGWMTGL VQRTGRQGMLPANYVEPAQI |
 Top
| |