| Protein: 328785112 XP_394993.2 PREDICTED: proteasome subunit beta type-4-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 58.1 | 41.9 | 1.3866348 | ||
| Scape | 29.5 | 35 | 35.5 | 0.8309859 | 0.9859155 |
| Brain | 43.5 | 56.5 | 0.7699115 | ||
| Crop | 31.3 | 30.8 | 37.9 | 0.8258575 | 0.8126649 |
| Eye | 59.7 | 40.3 | 1.4813895 | ||
| Intestine | 24.2 | 34.3 | 41.5 | 0.5831325 | 0.826506 |
| Leg, front | 36.8 | 31.7 | 31.6 | 1.164557 | 1.0031645 |
| Leg, middle | 39 | 26.8 | 34.2 | 1.1403508 | 0.7836257 |
| Leg, rear | 43.1 | 30.8 | 26.1 | 1.651341 | 1.1800766 |
| Mandibular gland | |||||
| Rectum | 40.1 | 59.9 | 0.6694491 | ||
| Salivary gland, cerebral | 42 | 8.3 | 49.8 | 0.8433735 | 0.16666667 |
| Salivary gland, thoracic | 35.4 | 29.5 | 35.1 | 1.0085471 | 0.84045583 |
| Sternite | 28.3 | 41.9 | 29.7 | 0.95286196 | 1.4107745 |
| Tergite | 5.4 | 70.9 | 23.6 | 0.22881356 | 3.0042372 |
| Ventriculus | 29.8 | 70.2 | 0.42450142 | ||
| Thoracic muscle | |||||
| Fat body | 21.9 | 35.1 | 43 | 0.5093023 | 0.81627905 |
| Malpighian tubules | 28.1 | 29.8 | 42.1 | 0.6674584 | 0.7078385 |
| Nerve chord | 22.6 | 34.9 | 42.6 | 0.53051645 | 0.81924886 |
| Poison sac | |||||
| Sting | 57.7 | 42.3 | 1.3640662 | ||
| Heart | 19.6 | 42.6 | 37.8 | 0.5185185 | 1.1269841 |
| Hypopharyngeal gland | 53.9 | 46.1 | 1.1691974 | ||
| Galea | 42.5 | 57.5 | 0.73913044 | ||
| Glossa | 66 | 34 | 1.9411764 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.2 | 39.7 | 41.7 | 0.7721822 | 0.95203835 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTFQSVLLIKNMALNKADWQTPAPLWQNGPVPGAFYHFPGNSTHFKVGGYQRSQAPMTTG TSVVGIQFKNGILIATDILGSYGSLARYRNLERVMKVNDNIILGAGGDYADYQCLKSHIE RKILEEECLDDGLSLKPKALHCWLTRVLYNRRSQFDPFWNNFIIGGLEGDKLFLGTVDKL GTAYSDPVIATGYGAYMATPILRKAYEENKEMSKEQAIELLYKVMQVLYYRDARSFPKYQ VGVITREEGVEIQGPLTLDSYWGPAIM |
 Top
| |