| Protein: 328793353 XP_624662.2 PREDICTED: glutathione S-transferase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.7 | 37.7 | 25.6 | 1.4335938 | 1.4726562 |
| Scape | 28.2 | 42.3 | 29.5 | 0.9559322 | 1.4338983 |
| Brain | 43.3 | 29.5 | 27.2 | 1.5919118 | 1.0845588 |
| Crop | 57.6 | 14.1 | 28.3 | 2.0353358 | 0.49823323 |
| Eye | 24.2 | 34.9 | 40.9 | 0.591687 | 0.85330075 |
| Intestine | 36.6 | 33.6 | 29.8 | 1.2281879 | 1.1275167 |
| Leg, front | 31.6 | 42.7 | 25.7 | 1.2295719 | 1.6614786 |
| Leg, middle | 31.7 | 39.9 | 28.4 | 1.1161972 | 1.4049295 |
| Leg, rear | 31 | 37.5 | 31.4 | 0.9872611 | 1.1942675 |
| Mandibular gland | 59.4 | 14.9 | 25.6 | 2.3203125 | 0.58203125 |
| Rectum | 45.7 | 41.6 | 12.7 | 3.5984251 | 3.2755907 |
| Salivary gland, cerebral | 22.3 | 42 | 35.7 | 0.6246499 | 1.1764706 |
| Salivary gland, thoracic | 42.4 | 23 | 34.6 | 1.2254335 | 0.6647399 |
| Sternite | 33.5 | 37.1 | 29.4 | 1.1394558 | 1.2619047 |
| Tergite | 29.6 | 48.2 | 22.2 | 1.3333334 | 2.1711712 |
| Ventriculus | 35.8 | 17.2 | 47.1 | 0.7600849 | 0.36518046 |
| Thoracic muscle | 18.8* | 78.9* | 2.3 | 8.173913 | 34.304348 |
| Fat body | 84.8 | 7.6 | 7.6 | 11.157895 | 1 |
| Malpighian tubules | 39.4 | 35 | 25.7 | 1.5330739 | 1.3618677 |
| Nerve chord | 26.9 | 44.9 | 28.2 | 0.9539007 | 1.5921986 |
| Poison sac | 42.7 | 57.3 | 0.7452007 | ||
| Sting | 65.6 | 34.4 | 1.9069767 | ||
| Heart | 34.9 | 28 | 37.1 | 0.9407008 | 0.754717 |
| Hypopharyngeal gland | 38.9 | 61.1 | 0.63666123 | ||
| Galea | 37.7 | 31.5 | 30.8 | 1.224026 | 1.0227273 |
| Glossa | 36.7 | 32.6 | 30.7 | 1.1954397 | 1.0618893 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.8 | 36.2 | 30.4 | 1.2434211 | 1.1907895 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTERQPLYKLIYFNARGRAEHIRYIFAYAGIDYVDERILKECWPELKKSTPFGQVPVLDV DGKKIAQSVAISRYLAKKSGLAGKDDWEALEIDSIVDTIHDVRARLAAFHYEENEEIKAA KRKIADEVVPYYLERLDAQVKNNGGYFVGGALSWADLSFVALLDYLNFMNGSDLIEKYDN LKQLKEKVLNLPAIKSWLDKRPHSDF |
 Top
| |