| Protein: 58585146 NP_001011603.1 arginine kinase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.5 | 36.7 | 36.7 | 0.7220709 | 1 |
| Scape | 28.9 | 32 | 39.1 | 0.73913044 | 0.81841433 |
| Brain | 46.2 | 23.9 | 30 | 1.54 | 0.7966667 |
| Crop | 57.6 | 14.2 | 28.2 | 2.0425532 | 0.5035461 |
| Eye | 38.1 | 27.8 | 34.1 | 1.1173021 | 0.81524926 |
| Intestine | 32.1 | 27 | 40.9 | 0.78484106 | 0.6601467 |
| Leg, front | 41.3 | 27.9 | 30.8 | 1.3409091 | 0.90584415 |
| Leg, middle | 37.9 | 28.4 | 33.7 | 1.124629 | 0.84273 |
| Leg, rear | 32.6 | 30 | 37.4 | 0.8716577 | 0.80213904 |
| Mandibular gland | 67.2 | 2.8 | 30 | 2.24 | 0.093333334 |
| Rectum | 30.3 | 43.9 | 25.8 | 1.1744186 | 1.7015504 |
| Salivary gland, cerebral | 9.8 | 45.4 | 44.8 | 0.21875 | 1.0133928 |
| Salivary gland, thoracic | 32 | 42.2 | 25.8 | 1.2403101 | 1.6356589 |
| Sternite | 70 | 17.9 | 12.1 | 5.785124 | 1.4793389 |
| Tergite | 87.1 | 6.4 | 6.5 | 13.4 | 0.9846154 |
| Ventriculus | 39.5 | 33 | 27.5 | 1.4363636 | 1.2 |
| Thoracic muscle | 93.2* | 6.8 | 13.705882 | ||
| Fat body | 81.6 | 12.8 | 5.6 | 14.571428 | 2.2857144 |
| Malpighian tubules | 61.2* | 20.4 | 18.4 | 3.326087 | 1.1086956 |
| Nerve chord | 33.2 | 38 | 28.8 | 1.1527778 | 1.3194444 |
| Poison sac | |||||
| Sting | 27.1 | 72.9 | 0.3717421 | ||
| Heart | 65.1* | 14.4 | 20.5 | 3.1756098 | 0.702439 |
| Hypopharyngeal gland | 91.8 | 8.2 | 11.195122 | ||
| Galea | |||||
| Glossa | 19.2 | 47.8 | 33 | 0.58181816 | 1.4484849 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.8 | 30.1 | 28.2 | 1.6595745 | 1.0673759 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVDQAVLDKLETGFSKLSSSDSKSLLKKYLSKDVFDQLKTKKTSFDSTLLDCIQSGIENL DSGVGIYAPDAEAYTLFADLFDPIIEDYHGGFKKTDKHPPKDFGDVDSLGNLDPANEFIV STRVRCGRSLEGYPFNPCLTEAQYKEMEEKVSSTLSGLEGELKGTFYPLTGMSKETQQKL IDDHFLFKEGDRFLQAANACRFWPTGRGIYHNDDKTFLVWCNEEDHLRIISMQMGGDLGQ VYRRLVHAVNEIEKRLLFSHNDRLGFLTFCPTNLGTTVRASVHIKLPKLAANRAKLEEIA GKFNLQVRGTRGEHTEAEGGIYDISNKRRLGLTEYQAVKEMHDGIAELIKLEKEL |
 Top
| |