| Protein: 328792507 XP_623784.2 PREDICTED: 26S protease regulatory subunit 10B |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.6 | 61.4 | 0.6286645 | ||
| Scape | 38.5 | 24.2 | 37.3 | 1.0321716 | 0.6487936 |
| Brain | |||||
| Crop | 48.5 | 51.5 | 0.94174755 | ||
| Eye | |||||
| Intestine | 19.4 | 37.2 | 43.3 | 0.44803694 | 0.8591224 |
| Leg, front | 26.2 | 33.4 | 40.5 | 0.6469136 | 0.82469136 |
| Leg, middle | 44.7 | 55.3 | 0.80831826 | ||
| Leg, rear | 55.1 | 44.9 | 1.2271715 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 14.6 | 70* | 15.4 | 0.9480519 | 4.5454545 |
| Sternite | |||||
| Tergite | 25.3 | 74.7 | 0.33868808 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 27.2 | 34.7 | 38.1 | 0.71391076 | 0.9107612 |
| Malpighian tubules | 32.2 | 25.1 | 42.7 | 0.75409836 | 0.587822 |
| Nerve chord | 43.4 | 56.6 | 0.7667844 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 25.8 | 34.1 | 40.1 | 0.64339155 | 0.85037404 |
| Hypopharyngeal gland | 58 | 42 | 1.3809524 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.6 | 40.6 | 46 | 0.70869565 | 0.8826087 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MATTVDSVREKALQDYRKKLIEHKEVESRLKEMREHLKDLTKQYDKSESDLKALQSVGQI VGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKNKLKSGTRVALDMTTLTIMRYLPREVD PLVYNMSHEDPGDVTYSAIGGLSEQIRELREVIELPLLNPELFQRVGITPPKGCLLYGPP GTGKTLLARAVASQLDANFLKVVSSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEID AIGGRRFSEGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHAGPIS KHGEIDYEAVVKLSDGFNGADLRNVCTEAGLFAIRLEREYVIQEDFMKAVRKVSDNKKLE SKLDYKPV |
 Top
| |