| Protein: 328786330 XP_624456.2 PREDICTED: probable saccharopine dehydrogenase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.1 | 36.7 | 29.1 | 1.1718214 | 1.2611684 |
| Scape | 32.4 | 36.3 | 31.3 | 1.0351437 | 1.1597444 |
| Brain | 55.7 | 44.3 | 1.2573364 | ||
| Crop | 53 | 24.6 | 22.4 | 2.3660715 | 1.0982143 |
| Eye | 27.9 | 43.9 | 28.2 | 0.9893617 | 1.5567375 |
| Intestine | 19.1 | 55.5 | 25.5 | 0.7490196 | 2.1764705 |
| Leg, front | 27.7 | 45.4 | 26.9 | 1.0297397 | 1.6877323 |
| Leg, middle | 26.4 | 41.4 | 32.2 | 0.8198758 | 1.2857143 |
| Leg, rear | 32 | 41.9 | 26 | 1.2307693 | 1.6115384 |
| Mandibular gland | 6 | 62.9 | 31.1 | 0.19292605 | 2.0225081 |
| Rectum | 25.8 | 36.2 | 38 | 0.6789474 | 0.9526316 |
| Salivary gland, cerebral | 4.4 | 92.9* | 2.7 | 1.6296296 | 34.407406 |
| Salivary gland, thoracic | 28.9 | 34.4 | 36.7 | 0.78746593 | 0.9373297 |
| Sternite | 22.1 | 29.6 | 48.3 | 0.45755693 | 0.6128364 |
| Tergite | 21.6 | 35.2 | 43.2 | 0.5 | 0.8148148 |
| Ventriculus | 24.3 | 26.3 | 49.4 | 0.49190283 | 0.5323887 |
| Thoracic muscle | |||||
| Fat body | 15.7 | 27.6 | 56.7 | 0.27689594 | 0.48677248 |
| Malpighian tubules | 25.3 | 36.6 | 38.1 | 0.664042 | 0.96062994 |
| Nerve chord | 13.1 | 64.5 | 22.4 | 0.5848214 | 2.8794644 |
| Poison sac | 79.4 | 20.6 | 3.854369 | ||
| Sting | 43.9 | 56.1 | 0.7825312 | ||
| Heart | 4.3 | 48.8 | 46.9 | 0.09168444 | 1.0405117 |
| Hypopharyngeal gland | 36.9 | 63.1 | 0.58478606 | ||
| Galea | 30.1 | 21.2 | 48.7 | 0.6180698 | 0.43531826 |
| Glossa | 28.3 | 26.2 | 45.5 | 0.62197804 | 0.5758242 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23.9 | 43.4 | 36.5 | 0.6547945 | 1.1890411 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTDQRLDFIIFGATGFTGKYAVKIAVQLAVEKQMKFGVSGRRKQALEAIVKEFASNIDDV PIFIADLKDEESLKKMTSQAKVLINCCGPYRFYGEPIIKACIATHTHQIDVSGEPQYIEY IQLKYNKTAEEAGIYIISACGLDSIPCDLGVIFTQQKFDGEVNSIETYLNCWSSKINGAI INYGTYESAVYGIAHSHELRELRTKLYPEKLPELWPKLKTRGFIHKSSLSEGWSMIFPGA DRSVTLRTQRFLYEKYKQRPAQVQTYFTLNSFFAVLTTTIFGIIFLMLSKYEFGRNLLLK YPTFFSGGYVGYEVAKPEELDKIKFSITFKAEGWTEKLVEPTDKHKDPPNKVLITKVSGT NPGYGATCTMLLLSAITILKESDKIPVNGGVLSPGAAFGKTSLIEELIKKDIKFEVISSI EKAPIMNGISSQCTKIKDLNIYDDEDKHTMMIKKPGPLRTVSWSENVEESNLDVPGTPRT PRTSTTPGHEKCTFHHDLELDHRPPTREALLPEMSRSYKLLLSSLGEDPNRPGLLKTPER AAKAMLFFTKGYDQCIDDIINDAVFDEDHDEMVVVKDIEMFSMCEHHLVPFYGKVSIGYL PCKKILGLSKLARIVEIFSRRLQVQERLTKQIAVAVTKAVQPAGVAVVVEGVHMCMVMRG VQKINSKTVTSTMLGVFRDDPKTREEFLNLVHNK |
 Top
| |