| Protein: 328793790 XP_393370.3 PREDICTED: 26S proteasome non-ATPase regulatory subunit 12 partial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.7 | 59.3 | 0.68634063 | ||
| Scape | 40.7 | 13.8 | 45.5 | 0.8945055 | 0.30329672 |
| Brain | 43.9 | 56.1 | 0.7825312 | ||
| Crop | 40.2 | 25.6 | 34.2 | 1.1754386 | 0.748538 |
| Eye | |||||
| Intestine | 25.3 | 40 | 34.7 | 0.7291066 | 1.1527377 |
| Leg, front | 28.8 | 22.8 | 48.4 | 0.59504133 | 0.47107437 |
| Leg, middle | 34.9 | 23.1 | 42.1 | 0.8289786 | 0.5486936 |
| Leg, rear | 45.2 | 23 | 31.9 | 1.4169279 | 0.7210031 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 23 | 43.4 | 33.6 | 0.6845238 | 1.2916666 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 24.2 | 75.8 | 0.31926122 | ||
| Thoracic muscle | |||||
| Fat body | 25.7 | 34.3 | 39.9 | 0.64411026 | 0.8596491 |
| Malpighian tubules | 30.5 | 30.5 | 39.1 | 0.7800512 | 0.7800512 |
| Nerve chord | 33.9 | 66.1 | 0.5128593 | ||
| Poison sac | |||||
| Sting | 40.2 | 59.8 | 0.6722408 | ||
| Heart | 22.2 | 39.6 | 38.2 | 0.58115184 | 1.0366492 |
| Hypopharyngeal gland | 56.5 | 43.5 | 1.2988505 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.8 | 32.7 | 46.8 | 0.7008547 | 0.69871795 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
IFQLRARLLDFNKILKMEVDYSSNCDVKIPECKKLASEGKLHDALDQLLALEKLARTSAD VASTSRILVAIVQICLEAKNWAVLNEHIVLLSKRRSQLKRAVTAMVQECCTYVDKMPDKE TKIKLIETLRTVTEGKIYVEVERARLTHRLAKIKEEDGDISGAAAVMLELQVETYGSMSR LEKASLILEQMRLCLAKKDFMRTQIIAKKINVKFFNDENDEETQSLKLKYYDLMMELARH EGWHLELCRHNRAVLETPAVRDDPEKRHVALSRAVLYLVLAPHEPEQADLTHRLLSDKLL DEIPTYKELLRLFVNPELIKWSGLCEIYERDLKATEVFSLWTEEGRKRWADLRNRVVEHN IRIMAKYYTKITLTRMAELLDLPVEETEACLCSLVETGVINARTDRPAGVVRFTGTQEPA ALLDAWAASLSKLMSLVNHTTHLIHQEEMLAVAQS |
 Top
| |