| Protein: 328775859 XP_624341.2 PREDICTED: proteasome subunit alpha type-5 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.8 | 32 | 32.2 | 1.1118013 | 0.99378884 |
| Scape | 34.9 | 34 | 31 | 1.1258065 | 1.0967742 |
| Brain | 53.4 | 46.6 | 1.1459228 | ||
| Crop | 34.3 | 31.9 | 33.8 | 1.0147929 | 0.943787 |
| Eye | 3.9 | 45.2 | 50.8 | 0.076771654 | 0.8897638 |
| Intestine | 20.8 | 44.3 | 34.9 | 0.5959885 | 1.269341 |
| Leg, front | 38.2 | 32.1 | 29.7 | 1.2861953 | 1.080808 |
| Leg, middle | 27.5 | 39 | 33.5 | 0.8208955 | 1.1641791 |
| Leg, rear | 43.2 | 27.2 | 29.6 | 1.4594594 | 0.9189189 |
| Mandibular gland | 22.9 | 77.1 | 0.29701686 | ||
| Rectum | 22.1 | 45.7 | 32.2 | 0.6863354 | 1.4192547 |
| Salivary gland, cerebral | 29.1 | 30.8 | 40.1 | 0.7256858 | 0.7680798 |
| Salivary gland, thoracic | 35.8 | 28.5 | 35.6 | 1.005618 | 0.8005618 |
| Sternite | 25.6 | 40.6 | 33.8 | 0.75739646 | 1.2011834 |
| Tergite | 20.9 | 47.4 | 31.7 | 0.659306 | 1.4952681 |
| Ventriculus | 17.4 | 36.5 | 46.1 | 0.37744033 | 0.79175705 |
| Thoracic muscle | |||||
| Fat body | 27.2 | 35.4 | 37.3 | 0.72922254 | 0.9490617 |
| Malpighian tubules | 26.6 | 31.6 | 41.8 | 0.6363636 | 0.75598085 |
| Nerve chord | 22.7 | 31.8 | 45.6 | 0.49780703 | 0.69736844 |
| Poison sac | |||||
| Sting | 56.1 | 43.9 | 1.2779043 | ||
| Heart | 22.6 | 42.3 | 35 | 0.6457143 | 1.2085714 |
| Hypopharyngeal gland | 50 | 50 | 1 | ||
| Galea | 30 | 26.5 | 43.5 | 0.6896552 | 0.6091954 |
| Glossa | 13.5 | 48.7 | 37.8 | 0.35714287 | 1.2883598 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.4 | 38.7 | 39.7 | 0.6649874 | 0.9748111 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MFLTRSEYDHGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIATSEGVVLVVEKRITSSLME PTTVEKIVEIDKHIGCAASGLIADSRTMIDRARVECQNHWFVYNERMSVESTAQAVSNLA IQFGDSDDDGSAMSRPFGVAMLFAGIDEKGPQLYHMDPSGTFVQFDAKAIGSGNEGAQQN LQEVYHKSMTLQEAIKAALVILKQVMEEKLSDNNIEVMTMTPEKLFHMFTKAELQELTEN LVSLKEDSIRSRSNTSGPLPPVPSISMDG |
 Top
| |