![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66499547 XP_392145.2 PREDICTED: glucose dehydrogenase [acceptor] |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 87.7* | 12.3 | 7.130081 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 1.4* | 87.2* | 11.5 | 0.12173913 | 7.5826087 |
| Leg, middle | 0.4* | 88.6* | 11 | 0.036363635 | 8.054545 |
| Leg, rear | 8.6 | 63.9 | 27.5 | 0.31272727 | 2.3236363 |
| Mandibular gland | 1.4 | 89.9* | 8.7 | 0.16091955 | 10.333333 |
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 0.7* | 74.7* | 24.6 | 0.028455285 | 3.0365853 |
| Sternite | 2.5* | 54.6 | 42.9 | 0.05827506 | 1.2727273 |
| Tergite | 0.3 | 89.1 | 10.6 | 0.028301887 | 8.405661 |
| Ventriculus | 92.4* | 7.6 | 12.157895 | ||
| Thoracic muscle | |||||
| Fat body | 0.6* | 64 | 35.4 | 0.016949153 | 1.8079096 |
| Malpighian tubules | |||||
| Nerve chord | 0.2* | 92.4* | 7.4 | 0.027027028 | 12.486486 |
| Poison sac | 0* | 100 | 0 | ||
| Sting | 10.1 | 89.9 | 0.11234705 | ||
| Heart | 1.1* | 64.7 | 34.2 | 0.032163743 | 1.8918129 |
| Hypopharyngeal gland | |||||
| Galea | 6.5* | 52.9 | 40.5 | 0.16049382 | 1.3061728 |
| Glossa | 10.1 | 52.7 | 37.2 | 0.2715054 | 1.4166666 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 2.8 | 66.6 | 31.3 | 0.08945687 | 2.1277955 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MESCMTTSCSPMLHSSPVCIFTLFLQTLEASYYGLSNPNTYPRNRKQEILDSKIEFDFVI VGGGSAGSVLARRLTEVEDWKVLLVERGGYPLPETEIPGFFANNLGLKQDYAYKVENQEE ACLSQVDKRCRWSKGKALGGSSVINAMFYIFGNKRDFDTWENIGNPGWNYEQVLPYFRKS LSCSPEFIAKYGTDYCGTDGPLKIRNYNYTETDAINILSEAVQQAGYDILEPVNCDRFIG FGRAMGNIDNGQRQSCAKAFLSPVKNRENLYVMTSSRVDKILFEGERAVGVRITLDNDEP IEVKATKEVILSAGSIASPQILMLSGIGPKEHLNKMGIPTLVDLPVGMNLQDHVSWLSFY LRYTNESITPPFDEKNQLDDAVYEYLKQNTGPLRTLPVEFTGFVDVNDPHSKYPNVQFIF MPVQFLSQLRDYLRAFNVDNDLIKKIENDVKEMKIIFSSATLLKPLSRGFLELRSTNPAD PVKIYPNYFAEKEDFNTLLKSVNVIKNLLNTKVLKKYNMKLFYPDIPGCRHTKPGTDEYW ECNLKYLSTTLFHPCGTAMMGPANDSRAVVDSRLKVHGIENLRVIDASIMPEVTSGNTNA PTIMIGEKGADIIKEDWGIKI |
|
| |