| Protein: 328790710 XP_003251449.1 PREDICTED: 26S protease regulatory subunit 6B isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 22.6 | 77.4 | 0.29198965 | ||
| Brain | |||||
| Crop | 37.7 | 32.8 | 29.5 | 1.2779661 | 1.1118644 |
| Eye | |||||
| Intestine | 27.7 | 39.9 | 32.3 | 0.85758513 | 1.2352941 |
| Leg, front | 17.7* | 82.3 | 0.21506684 | ||
| Leg, middle | 14* | 86 | 0.1627907 | ||
| Leg, rear | 67.3 | 32.7 | 2.058104 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 6.2 | 93.8 | 0.06609808 | ||
| Salivary gland, thoracic | 34.7 | 30.2 | 35.1 | 0.988604 | 0.8603989 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.2 | 27.8 | 31.9 | 1.2601881 | 0.8714734 |
| Malpighian tubules | 33.7 | 26.8 | 39.5 | 0.85316455 | 0.67848104 |
| Nerve chord | 39 | 12.6 | 48.5 | 0.8041237 | 0.25979382 |
| Poison sac | |||||
| Sting | 50.1 | 49.9 | 1.004008 | ||
| Heart | 22.6 | 39.9 | 37.5 | 0.6026667 | 1.064 |
| Hypopharyngeal gland | 48.5 | 51.5 | 0.94174755 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 37.9 | 28.4 | 52 | 0.72884613 | 0.54615384 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDDMGIILPDKDVGEMECKPVIGHYTGAGDELDVEDLYTKYKKLQRMLEFLEVQEEYIKD EQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVGSTTGSNYYVRILSTIDREL LKPSASVALHKHSNALVDVLPPEADSSISMLQADEKPDIQYSDIGGMDMQKQEIREAVEL PLTHFELYKQIGIDPPRGVLMYGPPGCGKTMLAKAVARHTTAAFIRVVGSEFVQKYLGEG PRMVRDVFRLAKENSPAIIFVDEIDAIATKRFDAQTGADREVQRILLELLNQMDGFDQTT NVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLIFSTITAKMNLSEEVDLEDY VARPDRISGADINAICQEAGMHAVRENRYIVLAKDFEKGYKNNIKKDESEHEFYK |
 Top
| |