| Protein: 328788182 XP_001120199.2 PREDICTED: hypothetical protein LOC725148 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 33.9 | 27.8 | 38.3 | 0.8851175 | 0.72584856 |
| Brain | |||||
| Crop | 47.5 | 19.9 | 32.5 | 1.4615384 | 0.61230767 |
| Eye | 26 | 74 | 0.35135135 | ||
| Intestine | |||||
| Leg, front | 44.9 | 15.5 | 39.7 | 1.1309824 | 0.39042822 |
| Leg, middle | 44.5 | 14 | 41.5 | 1.0722891 | 0.33734939 |
| Leg, rear | 21 | 25.4 | 53.6 | 0.39179105 | 0.4738806 |
| Mandibular gland | 31.2 | 39.3 | 29.5 | 1.0576271 | 1.3322034 |
| Rectum | |||||
| Salivary gland, cerebral | 11.1 | 32.8 | 56.1 | 0.19786096 | 0.58467025 |
| Salivary gland, thoracic | 34.3 | 40.9 | 24.8 | 1.3830645 | 1.6491935 |
| Sternite | 47.3 | 22.9 | 29.8 | 1.5872483 | 0.7684564 |
| Tergite | 68 | 7.9 | 24 | 2.8333333 | 0.32916668 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 29.5 | 8* | 62.5 | 0.472 | 0.128 |
| Poison sac | |||||
| Sting | 9.9 | 90.1 | 0.10987791 | ||
| Heart | 40.9 | 15.3 | 43.8 | 0.93378997 | 0.34931508 |
| Hypopharyngeal gland | |||||
| Galea | 19.5 | 34.2 | 46.4 | 0.4202586 | 0.73706895 |
| Glossa | 25.6 | 25.6 | 48.8 | 0.52459013 | 0.52459013 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35 | 22.6 | 46 | 0.76086956 | 0.49130434 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSRPILSRPRTRVYGCNYDKGESYYKPMVDHLDRKYSSRPLFSEPRSSLADEIAARRGDI GTRDLSAPRNSPLGRDLDLELDPSIRCPQLPTPPSSATADNLFPEDEDVVYDSRGQRSRR RFADNFANDVAATTQHLKAKLAAIGLEDEVVDAVLGRSARQRVRQEQQEAGHEARRDIKS MIGGEQAETNTFKRRSKLFENEGEEGRPTVLAKWSKLMDESEDSIAGSAAATRARQTKAR LNDIESEMEELAERRAKRERRAAALRALINENIADTENLQEQSVVSKKVSIRERAEKHVA F |
 Top
| |