| Protein: 328781995 XP_395130.4 PREDICTED: probable trans-2-enoyl-CoA reductase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 24.2* | 75.8 | 0.31926122 | ||
| Scape | 28.5 | 39.9 | 31.6 | 0.90189874 | 1.2626582 |
| Brain | 35.3 | 33.8 | 31 | 1.1387097 | 1.0903226 |
| Crop | 18.9 | 48.3 | 32.7 | 0.57798165 | 1.4770643 |
| Eye | 71.8 | 28.2 | 2.5460992 | ||
| Intestine | 23 | 32.8 | 44.2 | 0.520362 | 0.74208146 |
| Leg, front | 25.5 | 33.4 | 41.1 | 0.620438 | 0.81265205 |
| Leg, middle | 34.2 | 32.8 | 33 | 1.0363636 | 0.9939394 |
| Leg, rear | 48.3 | 34.3 | 17.5 | 2.76 | 1.96 |
| Mandibular gland | 16.7 | 61.5 | 21.8 | 0.76605505 | 2.821101 |
| Rectum | |||||
| Salivary gland, cerebral | 67.2 | 16.9 | 15.9 | 4.226415 | 1.062893 |
| Salivary gland, thoracic | 37.5 | 28.5 | 34 | 1.1029412 | 0.8382353 |
| Sternite | 41.7 | 47.5 | 10.8 | 3.8611112 | 4.398148 |
| Tergite | 67.8 | 32.2 | 2.10559 | ||
| Ventriculus | |||||
| Thoracic muscle | 4.1 | 68.8 | 27.1 | 0.15129152 | 2.5387454 |
| Fat body | 20.1 | 52.4 | 27.6 | 0.7282609 | 1.8985507 |
| Malpighian tubules | 30.8 | 39.6 | 29.6 | 1.0405406 | 1.3378378 |
| Nerve chord | 31.1 | 28.9 | 40 | 0.7775 | 0.7225 |
| Poison sac | |||||
| Sting | 52.7 | 47.3 | 1.114165 | ||
| Heart | 34.1 | 33 | 32.9 | 1.0364741 | 1.0030395 |
| Hypopharyngeal gland | 74.8 | 25.2 | 2.9682539 | ||
| Galea | 66.6 | 33.4 | 1.994012 | ||
| Glossa | 26 | 45.4 | 28.6 | 0.90909094 | 1.5874126 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32.3 | 45 | 32.2 | 1.0031056 | 1.3975155 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIIYMKNLILSLSRSNMINLASVRHINTMIKTDSVKSLFYKEYGEPADVLHVTTQPINQP ENNEVSVKWLLAPVNPADINTIQGKYPSKPPLPAIPGNEGVGEVIAIGSNVKHLSVGDRV IPNGTNLGTWRTYANYTSEELMKVPKEIGTIEASMLNVNPCTAYRMLKDFVELKPGDTII QNGGNSAVGQMVIQLCKEWNYKSVSVVRDRPNIQELKNHLSSLGADEILTENEIRKTQIF KSKKLPSPKLALNCICGQNALEISRHLAHGGIMITYGGMSREPLTVPISALIFKDITFKG FWMTAWTKKNMDSIERQNMFRELGALFKNKKLKAPLHKLVPFHQYQEAVINALHTDGRTG VKYILDMTKL |
 Top
| |