| Protein: 295842195 NP_001171492.1 glutathione peroxidase-like 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 26.5 | 38.3 | 35.2 | 0.75284094 | 1.0880681 |
| Scape | 24.4 | 30.2 | 45.5 | 0.53626376 | 0.6637363 |
| Brain | 51.5 | 27.6 | 20.9 | 2.464115 | 1.3205742 |
| Crop | 40.1 | 13.6 | 46.3 | 0.8660907 | 0.2937365 |
| Eye | 37.5 | 40.6 | 21.9 | 1.7123288 | 1.8538812 |
| Intestine | 31 | 41 | 28 | 1.1071428 | 1.4642857 |
| Leg, front | 30.1 | 38.8 | 31.1 | 0.9678457 | 1.2475884 |
| Leg, middle | 29.4 | 39.6 | 31 | 0.9483871 | 1.2774193 |
| Leg, rear | 44.2 | 27.7 | 28.1 | 1.5729537 | 0.9857651 |
| Mandibular gland | 17.9 | 46.9 | 35.2 | 0.50852275 | 1.3323864 |
| Rectum | 33.3 | 32.6 | 34.1 | 0.9765396 | 0.9560117 |
| Salivary gland, cerebral | 52.3 | 31.3 | 16.5 | 3.169697 | 1.8969697 |
| Salivary gland, thoracic | 39.9 | 23.3 | 36.8 | 1.0842391 | 0.6331522 |
| Sternite | 28.3 | 41.3 | 30.4 | 0.9309211 | 1.3585526 |
| Tergite | 28.1 | 33.5 | 38.4 | 0.7317708 | 0.8723958 |
| Ventriculus | 11.5 | 43.7 | 44.8 | 0.25669643 | 0.9754464 |
| Thoracic muscle | 2.7 | 85.6 | 11.7 | 0.23076923 | 7.3162394 |
| Fat body | 31.8 | 28.8 | 39.4 | 0.8071066 | 0.7309645 |
| Malpighian tubules | 37.3 | 32 | 30.7 | 1.2149837 | 1.0423453 |
| Nerve chord | 21.7 | 46.6 | 31.7 | 0.6845426 | 1.4700315 |
| Poison sac | 4.2 | 95.8 | 0.043841336 | ||
| Sting | 38 | 62 | 0.61290324 | ||
| Heart | 27.7 | 30.8 | 41.5 | 0.66746986 | 0.74216866 |
| Hypopharyngeal gland | 73.8 | 26.2 | 2.816794 | ||
| Galea | 27 | 31.2 | 41.8 | 0.64593303 | 0.7464115 |
| Glossa | 24.4 | 34.7 | 40.9 | 0.596577 | 0.8484108 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.4 | 36.8 | 36.4 | 0.83516484 | 1.0109891 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSGNDNYKEAKSIYDFTAKSIKGEDVFLSKYKGHVCLIVNVASKCGLTATNYKELNELYD EYAESKGLRILAFPCNQFNGQEPGNSEDICNFADRQKVKFDLFEKIDVNGDSAHPLWKYL KKEQGGILGDFIKWNFTKFIVNKEGKVVERHGPNVAPSNLKNHLEKYF |
 Top
| |