| Protein: 66506276 XP_625254.1 PREDICTED: hypothetical protein LOC551541 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 24.7 | 40.9 | 34.4 | 0.71802324 | 1.1889535 |
| Scape | 26.4* | 8.9* | 64.7 | 0.4080371 | 0.13755795 |
| Brain | 37.9 | 21.1 | 41 | 0.92439026 | 0.51463413 |
| Crop | 26.4 | 73.6 | 0.35869566 | ||
| Eye | 64.9 | 35.1 | 1.8490028 | ||
| Intestine | 43.2 | 56.8 | 0.7605634 | ||
| Leg, front | 25.8 | 29.4 | 44.8 | 0.57589287 | 0.65625 |
| Leg, middle | 31.7 | 50.5 | 17.7 | 1.7909604 | 2.8531075 |
| Leg, rear | 16.2 | 25.4 | 58.4 | 0.27739725 | 0.43493152 |
| Mandibular gland | 22.7 | 33.8 | 43.5 | 0.5218391 | 0.7770115 |
| Rectum | |||||
| Salivary gland, cerebral | 30.4 | 69.6 | 0.43678162 | ||
| Salivary gland, thoracic | 32.4 | 36.6 | 31 | 1.0451612 | 1.1806451 |
| Sternite | 29.3 | 28.3 | 42.4 | 0.6910377 | 0.6674528 |
| Tergite | 31.3 | 30 | 38.7 | 0.80878556 | 0.7751938 |
| Ventriculus | |||||
| Thoracic muscle | 22 | 65.7 | 12.3 | 1.7886178 | 5.3414636 |
| Fat body | 68.6 | 31.4 | 2.1847134 | ||
| Malpighian tubules | 43.2 | 37.5 | 19.2 | 2.25 | 1.953125 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 49 | 51 | 0.9607843 | ||
| Heart | 44 | 24.4 | 31.6 | 1.392405 | 0.7721519 |
| Hypopharyngeal gland | 73.2 | 26.8 | 2.7313433 | ||
| Galea | 34 | 35.7 | 30.3 | 1.1221122 | 1.1782178 |
| Glossa | 51.9 | 18 | 30.1 | 1.7242525 | 0.59800667 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.1 | 37.9 | 40.2 | 0.8233831 | 0.9427861 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFHQFNAFTGRLKQSTQLQALYPLSPKALEKIETPRMMFDSIKTKIASTSSSLSRHHST IPQKMKKLQQEWQADLLKPTFLLRGASDMAIYRLTIATTLIGFVINLYYINELRMKFR |
 Top
| |