| Protein: 328779673 XP_001120006.2 PREDICTED: protein lethal(2)essential for life-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 3.1* | 78.8* | 18 | 0.17222223 | 4.3777776 |
| Scape | 4.9* | 62.4 | 32.7 | 0.14984709 | 1.9082569 |
| Brain | |||||
| Crop | 21 | 46.4 | 32.6 | 0.6441718 | 1.4233129 |
| Eye | 35.7 | 39.1 | 25.1 | 1.4223107 | 1.557769 |
| Intestine | |||||
| Leg, front | 10.4* | 44.9 | 44.7 | 0.23266219 | 1.0044743 |
| Leg, middle | |||||
| Leg, rear | 85.7* | 14.3 | 5.993007 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 87.4* | 4.5 | 8.1 | 10.790123 | 0.5555556 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 20.9 | 79.1 | 0.2642225 | ||
| Fat body | 6.2* | 93.8 | 0.06609808 | ||
| Malpighian tubules | 57 | 6.5* | 36.5 | 1.5616438 | 0.1780822 |
| Nerve chord | 23.1 | 28.4 | 48.5 | 0.47628865 | 0.585567 |
| Poison sac | |||||
| Sting | |||||
| Heart | 21.4* | 78.6 | 0.27226463 | ||
| Hypopharyngeal gland | |||||
| Galea | 78* | 22 | 3.5454545 | ||
| Glossa | 73.4 | 26.6 | 2.7593985 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.9 | 40.8 | 40 | 0.8725 | 1.02 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MMSLLPLLFSAWWADLDRPHRIWDQNFGMGLYPEQLIFPSSIDSRIYSPLNNRAMLDFYY RPLSEFLRRDGGGTSTITADKDTFKVILDIQQFKPEEINVKLINRLVVVEAKHEEKKDEH GLISRQFIRKYLLPEQVDEEKLTSSVSSDGILIITAPLKQIEENLNERNIKVEFTGKPAL HADSKEQTADEKKPVSENENQELIENPEKK |
 Top
| |