| Protein: 328784195 XP_003250408.1 PREDICTED: thioredoxin-2 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.9 | 40.8 | 30.4 | 0.9506579 | 1.3421053 |
| Scape | 36.9 | 35.3 | 27.8 | 1.3273381 | 1.2697842 |
| Brain | 47.6 | 29 | 23.4 | 2.034188 | 1.2393162 |
| Crop | 43.5 | 9.5 | 47 | 0.9255319 | 0.20212767 |
| Eye | 46.9 | 53.1 | 0.88323915 | ||
| Intestine | 33.6 | 39 | 27.5 | 1.2218182 | 1.4181818 |
| Leg, front | 35.9 | 38.8 | 25.2 | 1.4246032 | 1.5396825 |
| Leg, middle | 36 | 37.9 | 26.1 | 1.3793104 | 1.4521073 |
| Leg, rear | 42.3 | 36.1 | 21.5 | 1.9674419 | 1.6790698 |
| Mandibular gland | 10.3 | 61.2 | 28.5 | 0.3614035 | 2.1473684 |
| Rectum | 44.6 | 34.6 | 20.8 | 2.1442308 | 1.6634616 |
| Salivary gland, cerebral | 44.8 | 34.8 | 20.4 | 2.1960785 | 1.7058823 |
| Salivary gland, thoracic | 32.9 | 26.6 | 40.5 | 0.8123457 | 0.65679014 |
| Sternite | 38.8 | 33.8 | 27.4 | 1.4160584 | 1.2335767 |
| Tergite | 32.2 | 39.6 | 28.2 | 1.1418439 | 1.4042553 |
| Ventriculus | 68.4 | 13 | 18.6 | 3.6774194 | 0.6989247 |
| Thoracic muscle | |||||
| Fat body | 46.1 | 28 | 25.9 | 1.7799227 | 1.081081 |
| Malpighian tubules | 47.1 | 27.7 | 25.1 | 1.876494 | 1.1035856 |
| Nerve chord | 31.1 | 44.9 | 24 | 1.2958333 | 1.8708333 |
| Poison sac | 31.4 | 68.6 | 0.45772594 | ||
| Sting | 41.2 | 58.8 | 0.70068026 | ||
| Heart | 37 | 31.2 | 31.8 | 1.163522 | 0.9811321 |
| Hypopharyngeal gland | 45.8 | 54.2 | 0.84501845 | ||
| Galea | 25.5 | 20.9 | 53.6 | 0.47574627 | 0.38992536 |
| Glossa | 12.3 | 26.1 | 61.6 | 0.19967532 | 0.4237013 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.9 | 34.2 | 34.8 | 1.0603448 | 0.98275864 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVYQIKNASDLKNQLEKAGNQLVVIDFFAMWCGPCKMIGPKVEELSMEMEDVIFLKVDVD ECEDIAGEYEITSMPTFVFIKNNKVLENFSGANYDKLKSTIQKHK |
 Top
| |