| Protein: 328777160 XP_001120627.2 PREDICTED: endocuticle structural glycoprotein SgAbd-2-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 39.6 | 30.8 | 29.6 | 1.3378378 | 1.0405406 |
| Scape | 48.7 | 30.8 | 20.5 | 2.3756099 | 1.502439 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 50.4 | 15.9 | 33.7 | 1.495549 | 0.4718101 |
| Leg, middle | 59 | 12.8 | 28.2 | 2.0921986 | 0.4539007 |
| Leg, rear | 13.6 | 33.2 | 53.2 | 0.2556391 | 0.62406015 |
| Mandibular gland | 80.3 | 19.7 | 4.0761423 | ||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | 67.4 | 19 | 13.6 | 4.9558825 | 1.3970588 |
| Tergite | 61.9 | 2.9* | 35.2 | 1.7585227 | 0.08238637 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 77.4* | 22.6 | 3.4247787 | ||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 32.5 | 31.5 | 36 | 0.9027778 | 0.875 |
| Glossa | 21.5 | 40.3 | 38.3 | 0.5613577 | 1.0522193 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.5 | 29.5 | 30.1 | 1.5780731 | 0.9800664 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MEENIKAKTCFICIPTISENMAIIVHKKQNCAMYFRTICILSLMAMALAADQPIAIIRQN QDISPDGTFHSKWESANGITFEEEGVLKNRGQKDAEAEEVRGSASWTAPDGTRINVDWLA NENGATFQGAHLPTPPPTQPVPVLIQRALDWIVANPEKNRL |
 Top
| |