| Protein: 328786921 XP_003250858.1 PREDICTED: dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 36.9 | 26.7 | 36.4 | 1.0137362 | 0.73351645 |
| Scape | 34.4 | 31.8 | 33.8 | 1.0177515 | 0.9408284 |
| Brain | 34 | 39.6 | 26.4 | 1.2878788 | 1.5 |
| Crop | 26.4 | 37.1 | 36.5 | 0.72328764 | 1.0164384 |
| Eye | 69.2 | 30.8 | 2.2467532 | ||
| Intestine | 35.3 | 21.2 | 43.5 | 0.81149423 | 0.48735633 |
| Leg, front | 31 | 30 | 39 | 0.7948718 | 0.7692308 |
| Leg, middle | 32.9 | 29.7 | 37.4 | 0.87967914 | 0.7941176 |
| Leg, rear | 33.5 | 31.4 | 35.2 | 0.95170456 | 0.89204544 |
| Mandibular gland | 38.2 | 24.3 | 37.5 | 1.0186666 | 0.648 |
| Rectum | 42.6 | 57.4 | 0.74216026 | ||
| Salivary gland, cerebral | 25.6 | 46.7 | 27.7 | 0.9241877 | 1.6859206 |
| Salivary gland, thoracic | 23.4 | 48.9 | 27.6 | 0.84782606 | 1.7717391 |
| Sternite | 56.4 | 22.9 | 20.7 | 2.7246377 | 1.1062802 |
| Tergite | 26.6 | 40.2 | 33.1 | 0.8036254 | 1.2145015 |
| Ventriculus | 28.8 | 71.2 | 0.40449437 | ||
| Thoracic muscle | 27.5 | 38 | 34.5 | 0.79710144 | 1.1014493 |
| Fat body | 29 | 43.7 | 27.2 | 1.0661764 | 1.6066177 |
| Malpighian tubules | 36.4 | 23.6 | 40 | 0.91 | 0.59 |
| Nerve chord | 39.8 | 13.8 | 46.4 | 0.85775864 | 0.2974138 |
| Poison sac | |||||
| Sting | 60.4 | 39.6 | 1.5252526 | ||
| Heart | 39.6 | 24.7 | 35.7 | 1.1092438 | 0.69187677 |
| Hypopharyngeal gland | 89.6 | 10.4 | 8.615385 | ||
| Galea | 29.9 | 19.9 | 50.2 | 0.59561753 | 0.39641434 |
| Glossa | 23.9 | 32.3 | 43.8 | 0.5456621 | 0.7374429 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.1 | 35 | 36.9 | 0.9512195 | 0.9485095 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDAALEMRERFNKILEKEKVKLSINDIIIKGMAMACKKVPEGNSSWLGEVIRQYNNVDVS VAVSTDTGLITPIVFGADTKGIVQISKDVKVLATKAREGKLKPQEFQGGTITVSNLGMFG IKNFSAIINPPQSIILAVGSTETRLIPAKNEKGYTSSQFMSVTASCDHRTVDGAIGAQWL SVFKNFMENPTSMLL |
 Top
| |