| Protein: 48094573 XP_397512.1 PREDICTED: hypothetical protein LOC408608 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 98.4* | 1.6 | 61.5 | ||
| Brain | |||||
| Crop | 3.1* | 96.9 | 0.031991743 | ||
| Eye | |||||
| Intestine | 15.7* | 1.9* | 82.4 | 0.19053398 | 0.023058252 |
| Leg, front | 10.9* | 33.4 | 55.7 | 0.1956912 | 0.5996409 |
| Leg, middle | 54.8 | 45.2 | 1.2123893 | ||
| Leg, rear | 3.7* | 34.9 | 61.4 | 0.060260586 | 0.5684039 |
| Mandibular gland | |||||
| Rectum | 53.3 | 46.7 | 1.1413276 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 90.5* | 0.1* | 9.4 | 9.62766 | 0.010638298 |
| Sternite | |||||
| Tergite | 75.5 | 24.5 | 3.0816326 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 0.9* | 1.1* | 98 | 0.009183673 | 0.01122449 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 54.6 | 45.4 | 1.2026432 | ||
| Glossa | 54.7 | 45.3 | 1.2075055 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 25.4 | 41 | 51 | 0.49803922 | 0.8039216 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQLRVLFFFLFVATISYAIADSSSSSSESKETAVDALKNIGKSADNIVKQFGKGFAAVAK GNLGTVNLTKVLKSVEDRLKLPTLSKYSKEAKSQIVAAREQVANALLEGSSDLIGALKDA VELAIRASTPIENLIEIFDTIKDVYFHVAVNNSIAIGLNIIEDGVLICQVIVETMKVALK V |
 Top
| |