| Protein: 328793697 XP_392955.3 PREDICTED: protein NipSnap |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.2 | 64.8 | 0.54320985 | ||
| Scape | 25.4 | 38 | 36.6 | 0.6939891 | 1.0382514 |
| Brain | 47.7 | 52.3 | 0.9120459 | ||
| Crop | 11* | 89 | 0.12359551 | ||
| Eye | |||||
| Intestine | 2.7* | 40.7 | 56.7 | 0.04761905 | 0.7178131 |
| Leg, front | 30.2 | 40.5 | 29.3 | 1.0307168 | 1.3822526 |
| Leg, middle | 28.7 | 46.6 | 24.6 | 1.1666666 | 1.8943089 |
| Leg, rear | 53.3 | 26.8 | 19.9 | 2.678392 | 1.3467337 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 88.2 | 1.9 | 9.9 | 8.909091 | 0.1919192 |
| Salivary gland, thoracic | 35.2 | 28.8 | 35.9 | 0.9805014 | 0.8022284 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 3 | 84.5 | 12.5 | 0.24 | 6.76 |
| Fat body | 10.5 | 49.2 | 40.3 | 0.2605459 | 1.2208437 |
| Malpighian tubules | 32.7 | 23.9 | 43.4 | 0.75345623 | 0.55069125 |
| Nerve chord | 27.7 | 36.3 | 36.1 | 0.767313 | 1.0055401 |
| Poison sac | |||||
| Sting | 43.5 | 56.5 | 0.7699115 | ||
| Heart | 24.2 | 35.3 | 40.5 | 0.59753084 | 0.8716049 |
| Hypopharyngeal gland | 91 | 9 | 10.111111 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.6 | 40.4 | 38.7 | 0.7906977 | 1.0439277 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAAVLRRFSAAQITVISKTKLPSFIISRSFARSSIRQDISEGWINKLSVRKIEPTKESHS RMLSDKGVIYALHTHNIRPDSIDNYLTNYEEIVNIINSKKSELKLELVGSWTVVAGDIDQ ALHLWQYSGGYDSVDHTQIELSKDKAYQQLFKENGNYLRSRYLHYRLQPGTMIEWGNNWA KAINYRRNNNEPFAGFFSQIGRLYNVHHIWCYKNLQARMETRESAWRLPGWDECVAYTVP LIRETHSRILSPTSFSPTK |
 Top
| |