| Protein: 328787515 XP_003250960.1 PREDICTED: mitochondrial ribonuclease P protein 1 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 54.4 | 45.6 | 1.1929824 | ||
| Scape | 64.3 | 35.7 | 1.8011204 | ||
| Brain | |||||
| Crop | 52.3 | 47.7 | 1.096436 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 37.6 | 62.4 | 0.6025641 | ||
| Leg, middle | 36.4 | 28.7 | 34.8 | 1.045977 | 0.82471263 |
| Leg, rear | 37.9 | 62.1 | 0.61030596 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 35.7 | 64.3 | 0.55520993 | ||
| Sternite | 56.5 | 43.5 | 1.2988505 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 67.8 | 32.2 | 2.10559 | ||
| Malpighian tubules | 34.5 | 26.6 | 38.9 | 0.88688946 | 0.68380463 |
| Nerve chord | 50.4 | 49.6 | 1.016129 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 50.3 | 15.5 | 34.2 | 1.4707602 | 0.45321637 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 47.3 | 35.3 | 45.9 | 1.0305011 | 0.7690632 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MYDRFCLNFVTFVTKIYSNVSIQNAHKITISQFRIPIQVHVRNYCKGNPSKIIFDHYNKI YEKELQVLLEDPKYKAIYDRYNLELESIKYNTGRVPKTLTASNWFPLLKSSTKPQKRSYI AFLWKLEKKEEHRQEKKLKKKEKKEIEEIKKNEKYLLGNSLFFRIRDQAINEFYNSRLIS AMLHEPTIIYDLGYDEYMDPFEKENCAKQLLLSFSTNRIHEEPFNLYFCNVNYENRVMQK FHKLLPQLYEPHFPLNITSKSYLEIFDKNQLVYLTPNAQTILENFDPNLIYIIGGIVDKR DIKPYSFQKANKEGIKMMRLPLSEMLNWGTGSSKNLPLNQVLHIMLELKRTKNWTEALNV IPKRKLKEIKEKEQKRKQDIIMYKFYR |
 Top
| |