![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66516828 XP_623981.1 PREDICTED: programmed cell death protein 5-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.1 | 34.6 | 21.3 | 2.0704226 | 1.6244131 |
| Scape | 29.3 | 25.6 | 45.1 | 0.6496674 | 0.5676275 |
| Brain | 48.8 | 51.2 | 0.953125 | ||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 26.4* | 73.6 | 0.35869566 | ||
| Leg, rear | 47.5 | 52.5 | 0.9047619 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 52.8 | 47.2 | 1.1186441 | ||
| Sternite | 79.1 | 20.9 | 3.784689 | ||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | 47.4 | 52.6 | 0.9011407 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.7 | 42.8 | 45.6 | 0.9802632 | 0.9385965 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSDPELEAIRQQRLAQLQSQYKNNNAENKQAMEEKIQQMEDMRNSILSQVLDQSARARLN TLCLGKPEKGKMVEDMILSMAQRGQLPGKLGEKELISLLESVNQQTQRKTVVKFDRRRAA LDSDDDL |
|
| |