| Protein: 66523464 XP_625050.1 PREDICTED: cytochrome b-c1 complex subunit 2 mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.7 | 28.3 | 36.9 | 0.9403794 | 0.7669377 |
| Scape | 37.7 | 27.6 | 34.7 | 1.0864553 | 0.79538906 |
| Brain | 30.9 | 34.8 | 34.3 | 0.9008746 | 1.0145773 |
| Crop | 28.8 | 37.8 | 33.4 | 0.8622754 | 1.1317365 |
| Eye | 16.3 | 45.7 | 37.9 | 0.43007916 | 1.2058047 |
| Intestine | 32.8 | 27.3 | 39.9 | 0.82205516 | 0.68421054 |
| Leg, front | 27.4 | 34.6 | 38 | 0.72105265 | 0.91052634 |
| Leg, middle | 41.5 | 32.6 | 26 | 1.5961539 | 1.2538462 |
| Leg, rear | 20.3 | 30.2 | 49.5 | 0.410101 | 0.610101 |
| Mandibular gland | 50.2 | 12.4 | 37.5 | 1.3386667 | 0.33066666 |
| Rectum | 44.7 | 21.6 | 33.8 | 1.3224852 | 0.6390532 |
| Salivary gland, cerebral | 30.4 | 26.5 | 43.2 | 0.7037037 | 0.6134259 |
| Salivary gland, thoracic | 19.6 | 56 | 24.3 | 0.80658436 | 2.3045268 |
| Sternite | 36.6 | 23.2 | 40.2 | 0.9104478 | 0.5771144 |
| Tergite | 36.3 | 26.3 | 37.4 | 0.9705882 | 0.70320857 |
| Ventriculus | 5.8 | 17.8 | 76.4 | 0.07591623 | 0.23298429 |
| Thoracic muscle | 10.8 | 72.1 | 17.1 | 0.6315789 | 4.2163744 |
| Fat body | 36.4 | 41.8 | 21.8 | 1.6697248 | 1.9174312 |
| Malpighian tubules | 40.9 | 28.7 | 30.4 | 1.3453947 | 0.9440789 |
| Nerve chord | 29.7 | 34.9 | 35.3 | 0.8413598 | 0.98866856 |
| Poison sac | |||||
| Sting | 36.8 | 63.2 | 0.5822785 | ||
| Heart | 38.9 | 24.9 | 36.2 | 1.0745857 | 0.6878453 |
| Hypopharyngeal gland | 87.3 | 12.7 | 6.874016 | ||
| Galea | 35.3 | 24.9 | 39.8 | 0.8869347 | 0.6256281 |
| Glossa | 49.9 | 16.1 | 34 | 1.4676471 | 0.4735294 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 32 | 34 | 36.6 | 0.87431693 | 0.92896175 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVSSVVRSSLLYPTVRHYAVAATVSKCAALAPEIKVLNNKVTVAAYDNHAPIAQVSIVFR AGSRNETHDTQGTAHYLRIAAGLSTSCATSFAITRNIQQRGGNLITTVDRESIAYTLQIT KNNLVDALQYLEFAATKQIFKPWEIADELPRLKYELFSLSDAVLILELLHKAAYRSGLGY SLFCPEYQLGKIGTESLQHFVNTWCTAPRCAVVGTGVSLSELTALGSNLSIESTDNTNEA SKYYGGEIRKETGTDLTTVAIAVEGVSLKNEKDALACAILQRASGSGPRVKWGSSPSSLH KQISTAAGREPFCLSTFNASYTDSGLFGVVLCSTSNVAGFLTKAAYEWLKCFKLSDDDIT RGKNILKTEILDAADNSLCLLESMQQQAVLKGKVSSPTSLANDIDKISASDVKDIADKLI KGKLSVAAIGNLKTVPYIDELK |
 Top
| |