| Protein: 66530530 XP_623625.1 PREDICTED: annexin-B9-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34.2 | 34.4 | 31.4 | 1.089172 | 1.0955414 |
| Scape | 33.8 | 39.3 | 26.9 | 1.2565056 | 1.4609666 |
| Brain | 29.6 | 37.4 | 33.1 | 0.8942598 | 1.1299094 |
| Crop | 41.2 | 25.7 | 33.1 | 1.244713 | 0.776435 |
| Eye | 9.8 | 56.9 | 33.3 | 0.2942943 | 1.7087088 |
| Intestine | 30.3 | 34.9 | 34.8 | 0.87068963 | 1.0028735 |
| Leg, front | 39.7 | 32.7 | 27.7 | 1.433213 | 1.1805054 |
| Leg, middle | 37.9 | 32.4 | 29.7 | 1.2760943 | 1.0909091 |
| Leg, rear | 32.2 | 38.5 | 29.3 | 1.0989761 | 1.3139932 |
| Mandibular gland | 55.7 | 2.6 | 41.6 | 1.3389423 | 0.0625 |
| Rectum | 40.8 | 18.6 | 40.6 | 1.0049261 | 0.45812806 |
| Salivary gland, cerebral | 61.8 | 22.7 | 15.5 | 3.9870968 | 1.4645162 |
| Salivary gland, thoracic | 44.8 | 17.8 | 37.4 | 1.197861 | 0.47593582 |
| Sternite | 22.5 | 33.1 | 44.4 | 0.5067568 | 0.7454955 |
| Tergite | 37.8 | 21.4 | 40.8 | 0.9264706 | 0.5245098 |
| Ventriculus | 20.3 | 18.2 | 61.5 | 0.3300813 | 0.29593495 |
| Thoracic muscle | 97.3* | 2.7 | 36.037037 | ||
| Fat body | 57.3 | 16.5 | 26.2 | 2.187023 | 0.629771 |
| Malpighian tubules | 30.1 | 27.3 | 42.6 | 0.7065728 | 0.64084506 |
| Nerve chord | 21.2 | 52.1 | 26.7 | 0.7940075 | 1.9513109 |
| Poison sac | 59.3 | 40.7 | 1.4570024 | ||
| Sting | 51.7 | 48.3 | 1.0703933 | ||
| Heart | 28.2 | 37.5 | 34.2 | 0.8245614 | 1.0964912 |
| Hypopharyngeal gland | 63.8 | 36.2 | 1.7624309 | ||
| Galea | 37.9 | 28.6 | 33.4 | 1.1347306 | 0.8562874 |
| Glossa | 20.4 | 49.3 | 30.3 | 0.6732673 | 1.6270627 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.9 | 36.5 | 33.9 | 1.0294986 | 1.0766962 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSASQYYHVQCTPTVYSADPFDPEQDASLLRAAMKGFGTDEQTIIDVLAHRGIVQRLEIS DKFKTMYGKDLISELKSELGGNFEKAILALMTPLPEFYAKELHEAISGMGTDEGALIEVL ASLSNYGIRTISAVYKELYDTDLEEDLKSDTSGHFKRLLVSLSCANRDENPDVDGEAAIQ DAERLLAAGEEQWGTDESTFNAILITKSYPQLRKIFEEYERLAGHSLEDAIKREFSGSLE DGYLAVVKCARDKTAYFAERLYKAMRGLGTDDSTLIRIVVARSEIDLGDIKDAYQKIYGQ SLAGDIDSDCSEDFKRLLIALLN |
 Top
| |