![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328793027 XP_393278.4 PREDICTED: hypothetical protein LOC409784 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 18.6 | 50.2 | 31.2 | 0.59615386 | 1.6089743 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 44.8 | 55.2 | 0.8115942 | ||
| Leg, front | 20.7 | 40.8 | 38.5 | 0.5376623 | 1.0597403 |
| Leg, middle | 26.6 | 34.5 | 38.9 | 0.68380463 | 0.88688946 |
| Leg, rear | 6.4 | 46.9 | 46.7 | 0.13704497 | 1.0042827 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 27.4 | 14.1 | 58.6 | 0.4675768 | 0.24061434 |
| Salivary gland, thoracic | 16.5 | 56 | 27.5 | 0.6 | 2.0363636 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 80.2* | 16.8* | 3 | 26.733334 | 5.6 |
| Malpighian tubules | 66.7* | 22.1 | 11.2 | 5.955357 | 1.9732143 |
| Nerve chord | 84.7* | 15.3 | 5.535948 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 52.7 | 19.3 | 28 | 1.8821429 | 0.6892857 |
| Hypopharyngeal gland | 91.5 | 8.5 | 10.764706 | ||
| Galea | |||||
| Glossa | 13.3* | 86.7 | 0.15340254 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.1 | 41.2 | 34.5 | 1.0173913 | 1.1942029 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MENAEDVKTIVELYIYDLTKGLASMMSRLVIGQHVEGIWHTAIVAYGREYFFGPSGIQSA RPGGTVLGEPLKVEKIGETYLPYSLFFEYINGLGTSTFAPGTYNLFKHNCNSFTNEVSNF LVGQDIPKYILDLPEEILKTPIGQQVGGLIEGLSNSSNKSYIVGQTFLESRNHREVSPEF QLLNEAIEEARLNSIALEERRNEINEKLAKKDRKKKKKKKDKRQKGSKDSASDSNSTDPS NYTHMAESESAVSLSEMQASNGESTEVLPSDRVMQMEEEEKKEQEEKKRHRDPPIVFKDV IDIKEEYQALIKILEGKLSEEERVCLDELRQYVLENEGSWALGDNFLNFVGRILYDKSLL NDARVKLLNILSVAALKDDVILLLHQDRREHIIMNYAFDIDRHPQEEQLPLAQFLANMFE NLSSSEWLLYISEWQYQTQNISNIRVTTKVAVHSLLSNSIDLQIRGAAIIHNLACKEVFD DVAVELTMALLQYFNGSPAEEQLYACMKSLARFTQISGQDVPQLIQMIGPEPNKFRGTSE RIDEQIDQVNKKLR |
|
| |