| Protein: 328786207 XP_396637.3 PREDICTED: brain protein 44-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 58.6 | 41.4 | 1.4154589 | ||
| Scape | 63.7 | 36.3 | 1.754821 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | 30.2 | 69.8 | 0.43266475 | ||
| Leg, middle | 19.3* | 80.7 | 0.23915738 | ||
| Leg, rear | 41.2 | 58.8 | 0.70068026 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 48.4 | 25.1 | 26.5 | 1.8264151 | 0.94716984 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 52.5 | 47.5 | 1.1052631 | ||
| Fat body | 55.1 | 44.9 | 1.2271715 | ||
| Malpighian tubules | 38* | 54.6* | 7.4 | 5.135135 | 7.3783784 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 25.9 | 19.3 | 54.8 | 0.47262773 | 0.35218978 |
| Hypopharyngeal gland | 37.9 | 62.1 | 0.61030596 | ||
| Galea | |||||
| Glossa | 38.2 | 61.8 | 0.618123 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 42.1 | 39.2 | 49.3 | 0.8539554 | 0.79513186 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSVIYKNTMNSIGKFVPQKFQPLWNHPAGPQTIFFWAPAFKWGLVIAGLGDLQRPASQIS ISQSTALGMTGLIWTRYSLAITPKNWSLFSVNLFVALTALYQVSRGIMYQREQTTLTATA SAKEK |
 Top
| |