![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328782568 XP_001120202.2 PREDICTED: serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 56.9 | 43.1 | 1.3201857 | ||
| Scape | 35.3 | 17.1 | 47.7 | 0.7400419 | 0.35849056 |
| Brain | |||||
| Crop | 37.8 | 62.2 | 0.60771704 | ||
| Eye | |||||
| Intestine | 26.9 | 37.5 | 35.7 | 0.7535014 | 1.0504202 |
| Leg, front | 36.1 | 22 | 41.9 | 0.8615752 | 0.52505964 |
| Leg, middle | 37.9 | 21.7 | 40.4 | 0.9381188 | 0.5371287 |
| Leg, rear | 40.9 | 30.7 | 28.4 | 1.4401408 | 1.0809859 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 32.9 | 30.9 | 36.2 | 0.90883976 | 0.85359114 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 44.7 | 32.4 | 23 | 1.9434782 | 1.4086957 |
| Malpighian tubules | 33.9 | 42.5 | 23.6 | 1.4364407 | 1.8008474 |
| Nerve chord | 18.2 | 59.8 | 22 | 0.8272727 | 2.7181818 |
| Poison sac | |||||
| Sting | |||||
| Heart | 25.8 | 36.9 | 37.2 | 0.6935484 | 0.9919355 |
| Hypopharyngeal gland | 43.8 | 56.2 | 0.77935946 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.4 | 34.4 | 38.3 | 0.92428195 | 0.8981723 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAASDSTTDDSLYPIAVLIDELKNEDVQLRLNSIKKLSTIALALGIERTRSELIPFLTES MYDEDEVLLALAEQLGQFTPLVGGPEYVHCLLKPLESLATVEETVVRDKAVESLRTIAAQ HSSTDLEEQFVPLIHRLATGDWFTSRTSACGLFSVCYPRVSPTVKACLRNHFRNLCQDDT PMARRSAASHLGEFAKVMEIEYVKADLIPMFVILAQDEQDSVRLLAIEACVSIAALLPQE DVEQLVMPTLRQCASDQSWRVRYMVADKFTDLQKAVGPEITKTDLVPAFQVLLKDIEAEV RAAAADKVRDFCQNLDKFNQESIIMTQILPIVKELVSDPNQHVKSALASVIMGLSPILGK HNTIEHLLPLFLSQLRDECSEVRLNIISNLECVNEVIGIQQLSQSLLPAIVELAEDSKWR VRYAIIEYMPLLAGQLGVEFFDEKLNSLCMTWLVDHVYAIREAATLNLKKLVEKFGPEWA QNTVIPKVLAMSRDQNYLHRMTCLFCINVLAEVCGPEITTRVMLPTVLGMATDNVANVRF NVAKTLQKIGPYLEPCAVQAQVKPVLDKLNTDSDVDVKYFASEAIAGIAA |
|
| |