| Protein: 66524108 XP_623128.1 PREDICTED: thioredoxin 1-like 1 isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.4 | 27.1 | 34.5 | 1.1130434 | 0.78550726 |
| Scape | 31.7 | 36.1 | 32.2 | 0.98447204 | 1.1211181 |
| Brain | 72.5* | 27.5 | 2.6363637 | ||
| Crop | 22.9 | 32.6 | 44.5 | 0.5146067 | 0.7325843 |
| Eye | |||||
| Intestine | 50.1 | 49.9 | 1.004008 | ||
| Leg, front | 45 | 24.9 | 30.1 | 1.4950166 | 0.82724255 |
| Leg, middle | 37 | 27.9 | 35.1 | 1.054131 | 0.7948718 |
| Leg, rear | 44.7 | 28.2 | 27.1 | 1.6494465 | 1.0405904 |
| Mandibular gland | 8.4 | 91.6 | 0.09170306 | ||
| Rectum | |||||
| Salivary gland, cerebral | 29.5 | 9.2 | 61.3 | 0.4812398 | 0.15008156 |
| Salivary gland, thoracic | 39.6 | 23.9 | 36.5 | 1.0849315 | 0.6547945 |
| Sternite | 35.1 | 64.9 | 0.54083204 | ||
| Tergite | 72.5 | 27.5 | 2.6363637 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.4 | 25.6 | 33 | 1.2545455 | 0.77575755 |
| Malpighian tubules | 34.3 | 34.7 | 30.9 | 1.1100323 | 1.1229774 |
| Nerve chord | 30.1 | 40.8 | 29.1 | 1.0343642 | 1.4020618 |
| Poison sac | |||||
| Sting | |||||
| Heart | 27.7 | 37.7 | 34.6 | 0.80057806 | 1.0895953 |
| Hypopharyngeal gland | 54.8 | 45.2 | 1.2123893 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.9 | 35.1 | 40.9 | 0.87775064 | 0.8581907 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGAVRVINDDGQFYGEMASAGTKLVVVDFTATWCGPCQRIAPIFEQLSLKYPNAVFLKVD VDKCAETAAMQGVSAMPTFIFYRNQTKLGLCQGADPTGLESKILQFYGSGDLEDSESPVS GHMDLATFITKAQSECLNESDDHNFLQCLNTDDGYLESECDEQLILSIAFSQAVKVHSLK IKAPKDKGPKNIKLFINQPRTIDFDMADSNTSIQDLTLSAKDIEEGNPIALRYVKFQNVQ NIQIFVKDNQTGNEVTRIDHLAIFGSPISTTNMGEFKRVNGKKGESH |
 Top
| |