| Protein: 328776893 XP_396106.4 PREDICTED: probable V-type proton ATPase 116 kDa subunit a-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38 | 23 | 39 | 0.974359 | 0.5897436 |
| Scape | 19.1 | 52.6 | 28.3 | 0.6749117 | 1.8586572 |
| Brain | 23.9 | 76.1 | 0.31406045 | ||
| Crop | 31.1 | 68.9 | 0.45137882 | ||
| Eye | |||||
| Intestine | 33.1 | 21.7 | 45.3 | 0.73068434 | 0.4790287 |
| Leg, front | 35.9 | 34.9 | 29.2 | 1.229452 | 1.1952055 |
| Leg, middle | 32.4 | 42.8 | 24.8 | 1.3064516 | 1.7258065 |
| Leg, rear | 40.2 | 59.8 | 0.6722408 | ||
| Mandibular gland | |||||
| Rectum | 54.6 | 22.9 | 22.4 | 2.4375 | 1.0223215 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 43 | 28.2 | 28.8 | 1.4930556 | 0.9791667 |
| Sternite | 44.8 | 4.3* | 50.8 | 0.88188976 | 0.084645666 |
| Tergite | 5 | 39 | 56 | 0.08928572 | 0.6964286 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.9 | 36.9 | 22.2 | 1.8423424 | 1.6621622 |
| Malpighian tubules | 74.6* | 0.9* | 24.5 | 3.044898 | 0.036734693 |
| Nerve chord | 13.5 | 49.7 | 36.8 | 0.3668478 | 1.3505435 |
| Poison sac | 88.1* | 11.9 | 7.4033613 | ||
| Sting | |||||
| Heart | 28.8 | 32.4 | 38.8 | 0.742268 | 0.83505154 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.7 | 33.7 | 39 | 0.9153846 | 0.86410254 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MGSLFRSEEMTLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE MERKLRYLEKEIKKDGIPMLDTGENPEAPQPREMIDLEATFEKLENELREVNQNAETLKR NFLELTELKHILRKTQVFFDEVRMNLLKFLCKVFM |
 Top
| |