| Protein: 283436154 NP_001164445.1 glutamine synthetase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 22.1 | 31.6 | 46.3 | 0.4773218 | 0.6825054 |
| Scape | 24.4 | 28.5 | 47.1 | 0.51804674 | 0.60509557 |
| Brain | 19.3 | 32.9 | 47.8 | 0.40376568 | 0.6882845 |
| Crop | 40 | 18.6 | 41.4 | 0.9661836 | 0.44927537 |
| Eye | 19.3 | 57.3 | 23.5 | 0.8212766 | 2.438298 |
| Intestine | 56 | 19.2 | 24.8 | 2.2580645 | 0.7741935 |
| Leg, front | 45.7 | 16.2 | 38.1 | 1.199475 | 0.42519686 |
| Leg, middle | 40 | 18.4 | 41.6 | 0.96153843 | 0.44230768 |
| Leg, rear | 57.5 | 11.3 | 31.2 | 1.8429487 | 0.3621795 |
| Mandibular gland | 89* | 11 | 8.090909 | ||
| Rectum | 35.5 | 64.5 | 0.5503876 | ||
| Salivary gland, cerebral | 90.7 | 2.3 | 7 | 12.957143 | 0.32857144 |
| Salivary gland, thoracic | 41.9 | 33.7 | 24.4 | 1.7172132 | 1.3811475 |
| Sternite | 50.2 | 36.8 | 13.1 | 3.832061 | 2.8091602 |
| Tergite | 54.3 | 21.1 | 24.6 | 2.207317 | 0.8577236 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.2 | 28.9 | 34.8 | 1.0402299 | 0.8304598 |
| Malpighian tubules | 57.4 | 12.3 | 30.3 | 1.8943894 | 0.4059406 |
| Nerve chord | 23.2 | 17.9 | 58.9 | 0.39388794 | 0.30390492 |
| Poison sac | |||||
| Sting | 44.8 | 55.2 | 0.8115942 | ||
| Heart | 22.8 | 41.7 | 35.5 | 0.6422535 | 1.1746479 |
| Hypopharyngeal gland | 64.5 | 35.5 | 1.8169014 | ||
| Galea | 23.1 | 52.1 | 24.8 | 0.9314516 | 2.1008065 |
| Glossa | 11.1 | 67.9 | 21 | 0.5285714 | 3.2333333 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.2 | 31.5 | 34 | 1.2117647 | 0.9264706 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSRVILRESPNAALDKTLLNKYLDLPQPENKIQAKYIWIDGTGESLRSKTRTVDFVPKHP SDLPIWTFDGSSTYQADGANSDIFLCPVAIYNDPFRRGNNKLVLCDTYYSDMTPTTSNKR SKCNQAMEAIKDEDPWFGIEQEYTFLDFDGRPLGWPKNGFPKPQGPYYCGVGADKVIGRE IVEAHYRACLYAGVKIAGTNAEVMPSQWEFQVGPCSGISAGDDLWIARFILHRVAEEFGV VVSLDPKIMDGSWNGAGAHTNFSTKSMRAENGIAEIEKAIDKLSKQHLRHIQAYDPRGGK DNERRLTGKCETSSIYDFSAGVANRNVSIRIPRGVAEEKKGYLEDRRPSSNCDPYSVCHA LVRTCVLNE |
 Top
| |