| Protein: 48103834 XP_395659.1 PREDICTED: protein lethal(2)essential for life-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 10.9 | 53.5 | 35.6 | 0.30617976 | 1.502809 |
| Scape | 29.4 | 35.4 | 35.2 | 0.83522725 | 1.0056819 |
| Brain | |||||
| Crop | 38.7 | 19.4 | 41.9 | 0.9236277 | 0.46300715 |
| Eye | 58.4 | 26.5 | 15.1 | 3.8675497 | 1.7549669 |
| Intestine | |||||
| Leg, front | 25.5 | 40.1 | 34.5 | 0.73913044 | 1.1623188 |
| Leg, middle | 27.2 | 35.7 | 37.1 | 0.73315364 | 0.9622642 |
| Leg, rear | 58.3 | 41.7 | 1.3980815 | ||
| Mandibular gland | 82.2 | 17.8 | 4.6179776 | ||
| Rectum | |||||
| Salivary gland, cerebral | 20.4 | 31.1 | 48.5 | 0.42061856 | 0.64123714 |
| Salivary gland, thoracic | 47.2 | 31.4 | 21.4 | 2.2056074 | 1.4672897 |
| Sternite | 44.6 | 34.9 | 20.5 | 2.1756098 | 1.7024391 |
| Tergite | 32.6 | 30.1 | 37.3 | 0.87399465 | 0.80697054 |
| Ventriculus | |||||
| Thoracic muscle | 54.2 | 45.8 | 1.1834061 | ||
| Fat body | 30.8 | 42.7 | 26.6 | 1.1578947 | 1.6052631 |
| Malpighian tubules | 73.5 | 1.5* | 25 | 2.94 | 0.06 |
| Nerve chord | 19.3 | 23.9 | 56.8 | 0.33978873 | 0.42077464 |
| Poison sac | |||||
| Sting | 60.4 | 39.6 | 1.5252526 | ||
| Heart | 33 | 23 | 43.9 | 0.75170845 | 0.523918 |
| Hypopharyngeal gland | 88.6 | 11.4 | 7.7719297 | ||
| Galea | 33.4 | 35.2 | 31.4 | 1.0636942 | 1.1210191 |
| Glossa | 39.8 | 34.5 | 25.7 | 1.5486381 | 1.3424125 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39 | 37.2 | 33 | 1.1818181 | 1.1272727 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALVTRDLFRNWWDDMDRYHRELEEHFKRLSTRDDFWKPPPMPSFNEFFQPWRNMMEQLE HQVGGSTTIERDQNKYQVIVDVQQFAPEEITVRTDDKCITIEGKHEEKKDEHGYVSRHFV RRYVLPQGYDIGHVKPSLSSDGILTITAPRLALPAPGERIIPIERSNAPAIKAA |
 Top
| |