| Protein: 66504360 XP_392760.2 PREDICTED: ATP synthase subunit O mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.9 | 26.1 | 31 | 1.383871 | 0.84193546 |
| Scape | 39.8 | 27.9 | 32.3 | 1.2321981 | 0.8637771 |
| Brain | 27.5 | 35.3 | 37.2 | 0.7392473 | 0.9489247 |
| Crop | 32.9 | 34.1 | 33 | 0.9969697 | 1.0333333 |
| Eye | 45.8 | 13.6* | 40.6 | 1.1280788 | 0.33497536 |
| Intestine | 33.5 | 27.2 | 39.4 | 0.8502538 | 0.6903553 |
| Leg, front | 34.9 | 21.8 | 43.3 | 0.80600464 | 0.5034642 |
| Leg, middle | 28.3 | 30.2 | 41.5 | 0.68192774 | 0.72771084 |
| Leg, rear | 23 | 30.6 | 46.4 | 0.49568966 | 0.6594828 |
| Mandibular gland | 26.1 | 28.2 | 45.7 | 0.571116 | 0.6170678 |
| Rectum | 29.4 | 39 | 31.6 | 0.93037975 | 1.2341772 |
| Salivary gland, cerebral | 24.1 | 30.9 | 45 | 0.53555554 | 0.68666667 |
| Salivary gland, thoracic | 30 | 39.9 | 30.1 | 0.99667776 | 1.3255814 |
| Sternite | 27.6 | 33.6 | 38.8 | 0.7113402 | 0.8659794 |
| Tergite | 22.3 | 32.6 | 45.1 | 0.49445677 | 0.72283816 |
| Ventriculus | 18.4 | 4.5* | 77.1 | 0.2386511 | 0.05836576 |
| Thoracic muscle | 19.5 | 64.1 | 16.5 | 1.1818181 | 3.8848486 |
| Fat body | 25.9 | 56.3 | 17.8 | 1.4550562 | 3.1629214 |
| Malpighian tubules | 40.4 | 29 | 30.6 | 1.3202615 | 0.9477124 |
| Nerve chord | 35.5 | 21 | 43.6 | 0.8142202 | 0.48165137 |
| Poison sac | 65.4 | 34.6 | 1.8901734 | ||
| Sting | 40.6 | 59.4 | 0.68350166 | ||
| Heart | 40 | 18.5 | 41.5 | 0.96385545 | 0.44578314 |
| Hypopharyngeal gland | 91.1 | 8.9 | 10.235955 | ||
| Galea | 40.9 | 18.9 | 40.3 | 1.0148883 | 0.46898264 |
| Glossa | 44.4 | 18.3 | 37.3 | 1.1903485 | 0.49061662 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.9 | 33.8 | 38 | 0.83947366 | 0.8894737 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSFSKIIVRSFFSSTAAQQLVKPPIQVFGIGGRYATALYSAGSKQKTLNNIEKDLLKFQD LMKQDQKLNEFVKNPAIKRKEKVEGLKSIGGKISLKSETINLLALLAENGRLSQINNVIN TFKLLMAATRGEVPCEVVTAKPLDAEMTSKLQTALKGFLSKGQSIMLTAKVDPSIMGGMI ISIGDKYIDMSVASKIKKYSDIIAETL |
 Top
| |