| Protein: 48097366 XP_393761.1 PREDICTED: GTP-binding nuclear protein Ran |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 32.3 | 32.1 | 35.5 | 0.9098592 | 0.90422535 |
| Scape | 31.9 | 27.3 | 40.8 | 0.78186274 | 0.6691176 |
| Brain | 33.8 | 26.8 | 39.4 | 0.857868 | 0.680203 |
| Crop | 48.9 | 51.1 | 0.95694715 | ||
| Eye | |||||
| Intestine | 65.9 | 34.1 | 1.9325513 | ||
| Leg, front | 49.7 | 22.1 | 28.2 | 1.7624114 | 0.78368795 |
| Leg, middle | 31.9 | 35.6 | 32.6 | 0.9785276 | 1.0920246 |
| Leg, rear | 33 | 40.1 | 26.9 | 1.2267658 | 1.4907063 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 55.3 | 44.7 | 1.2371365 | ||
| Salivary gland, thoracic | 34.6 | 28.3 | 37.1 | 0.93261456 | 0.76280326 |
| Sternite | |||||
| Tergite | 80.8 | 19.2 | 4.2083335 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 38.3 | 36.4 | 25.3 | 1.513834 | 1.4387351 |
| Malpighian tubules | 34.3 | 36.1 | 29.6 | 1.1587838 | 1.2195946 |
| Nerve chord | 33.4 | 39.5 | 27.1 | 1.2324723 | 1.4575646 |
| Poison sac | |||||
| Sting | 82* | 18 | 4.5555553 | ||
| Heart | 27.9 | 38.7 | 33.3 | 0.8378378 | 1.1621622 |
| Hypopharyngeal gland | 29.7 | 70.3 | 0.4224751 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.5 | 40.3 | 34.9 | 1.1031519 | 1.1547278 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAQEADIPTFKCVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLIFHTNRGPIRF NVWDTAGQEKFGGLRDGYYIQGQCAVIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LLPPEVTMDPQWQQQIEKDLKEAQETALPEDDEDL |
 Top
| |