![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328777195 XP_001123336.2 PREDICTED: v-type proton ATPase 116 kDa subunit a isoform 1-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 49.6 | 50.4 | 0.984127 | ||
| Scape | 10.1 | 89.9 | 0.11234705 | ||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 41.1 | 17.3 | 41.7 | 0.9856115 | 0.41486812 |
| Leg, front | 53.1 | 46.9 | 1.1321962 | ||
| Leg, middle | 49.5 | 50.5 | 0.980198 | ||
| Leg, rear | 27.2 | 41.8 | 31 | 0.87741935 | 1.3483871 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 55.2 | 16.9 | 27.9 | 1.9784946 | 0.60573477 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 38 | 19.4 | 42.6 | 0.8920188 | 0.45539907 |
| Malpighian tubules | 27.6 | 57.8 | 14.6 | 1.8904109 | 3.958904 |
| Nerve chord | 26.3 | 39.7 | 34 | 0.7735294 | 1.167647 |
| Poison sac | |||||
| Sting | |||||
| Heart | 13.5 | 49.6 | 37 | 0.36486486 | 1.3405405 |
| Hypopharyngeal gland | 38.9 | 61.1 | 0.63666123 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.8 | 35.8 | 44 | 0.7909091 | 0.81363636 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MADPSREEEQVTLLGEEGLRAGGQALKLGFVAGVILRERIPAFERMLWRACRGNVFLRQA EIETPLEDPSTGDQVFKSVFIIFFQGDQLKTRVKKICEGFRATLYPCPEAPADRREMAMG VMTRIEDLNTNRMVTFEDPPTYNRTNKFTKGFQALIDAYGVASYREMNPSPYTIITFPFL FAVMFGDTGHGLLMFLFGGWMVLKEKPLAAKKSDNEIWNIFFGGRYIIFLMGLFSMYTGL IYNDIFSKSLNIFGSYWRINYNFSTIDSNKELQLNPSDKEQYLQIPYPIGMDPVWQLAEN KIIFLNSYKMKISIIFGVIHMLFGVVIGLWNHMYFKRKLNITCEFIPQIIFLVFLFLYMV LLMFIKWIKYGPDSDNPEHGPSCAPSVLITFINMVLFKPGTAPKPCSPWMYGGQSGFQSF LVVIAVLCIPWMLLAKPIMLMNNRKKQHYQLNNHGTENGDVEGAVDAIQPANGVPQGGGH KEEEEDMAEVFIHQGIHTIEYVLGSVSHTASYLRLWALSLAHAQLSEVLWNMVMRNGLTQ EGWAGGIIIWAVFALWAVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYSGLGYGFQPFS FEIILDAAQSTAED |
|
| |