| Protein: 110757317-3_113161 113161 to 113745 585 bases. (111 amino acid fragment with 8 peptide hits) sequence correction |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 0.9* | 40.9 | 58.2 | 0.015463918 | 0.70274913 |
| Scape | 32.1 | 22.4 | 45.5 | 0.7054945 | 0.4923077 |
| Brain | 42 | 58 | 0.7241379 | ||
| Crop | 37.8 | 32.3 | 29.9 | 1.264214 | 1.0802675 |
| Eye | 52.5 | 47.5 | 1.1052631 | ||
| Intestine | 32 | 28.1 | 39.9 | 0.802005 | 0.70426065 |
| Leg, front | 39.7 | 26.6 | 33.7 | 1.1780416 | 0.7893175 |
| Leg, middle | 24.4 | 38.7 | 36.9 | 0.6612466 | 1.0487804 |
| Leg, rear | 22.1 | 38.2 | 39.7 | 0.5566751 | 0.9622166 |
| Mandibular gland | 29.2 | 70.8 | 0.4124294 | ||
| Rectum | 63.6 | 11.1 | 25.3 | 2.513834 | 0.4387352 |
| Salivary gland, cerebral | 18.6 | 38.2 | 43.2 | 0.43055555 | 0.8842593 |
| Salivary gland, thoracic | 31.3 | 37.3 | 31.4 | 0.99681526 | 1.187898 |
| Sternite | 38.9 | 25.9 | 35.2 | 1.1051136 | 0.73579544 |
| Tergite | 47.8 | 12 | 40.2 | 1.1890547 | 0.29850745 |
| Ventriculus | |||||
| Thoracic muscle | 19.1 | 64.1 | 16.9 | 1.1301775 | 3.7928994 |
| Fat body | 32.1 | 34.1 | 33.8 | 0.9497042 | 1.0088757 |
| Malpighian tubules | 24.6 | 51.9 | 23.5 | 1.0468085 | 2.2085106 |
| Nerve chord | 28.5 | 14.4 | 57.1 | 0.49912435 | 0.25218913 |
| Poison sac | |||||
| Sting | 28.3 | 71.7 | 0.39470014 | ||
| Heart | 38.2 | 29.4 | 32.4 | 1.1790123 | 0.9074074 |
| Hypopharyngeal gland | 54 | 46 | 1.173913 | ||
| Galea | 32.3 | 47.2 | 20.6 | 1.5679612 | 2.2912621 |
| Glossa | 20.9 | 49.8 | 29.3 | 0.7133106 | 1.6996588 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.7 | 34.9 | 40.3 | 0.7866005 | 0.86600494 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
STYLLSKEWYVMEHEFYNGLSLLSIIIYVQYKFGAKIGAFLDKGIDKDEEELNSQKNENI EEIQNQINELEKEKWCIDGQLMLYDVKKQNIWMQLEASYRENLATIHSQVR |
 Top
| |