| Protein: 328791302 XP_393760.4 PREDICTED: syntaxin-1A |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 51.1 | 48.9 | 1.0449898 | ||
| Scape | 48.6 | 10.7* | 40.7 | 1.1941032 | 0.26289925 |
| Brain | 28.1 | 10.6* | 61.3 | 0.4584013 | 0.17292006 |
| Crop | 83* | 17 | 4.882353 | ||
| Eye | |||||
| Intestine | 25.5 | 35.4 | 39.1 | 0.65217394 | 0.90537083 |
| Leg, front | 34.2 | 33.6 | 32.2 | 1.0621119 | 1.0434783 |
| Leg, middle | 52.9 | 47.1 | 1.1231422 | ||
| Leg, rear | 43.6 | 56.4 | 0.77304965 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 75.5* | 5.7 | 18.8 | 4.0159574 | 0.30319148 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 39.6 | 40.5 | 19.9 | 1.9899497 | 2.0351758 |
| Malpighian tubules | 80.5 | 19.5 | 4.1282053 | ||
| Nerve chord | 17.3 | 41.6 | 41.1 | 0.42092457 | 1.0121654 |
| Poison sac | |||||
| Sting | 80* | 20 | 4 | ||
| Heart | 6.5 | 57.4 | 36.1 | 0.1800554 | 1.5900277 |
| Hypopharyngeal gland | 58.9 | 41.1 | 1.43309 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.2 | 42.3 | 36 | 1.1444445 | 1.175 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTKDRLAALVAAQSDDDDVADDVSVNVGGPDDFMTEFFAEVEEIREMIDRIQTNVEDVKK KHSAILSAPQTDEKVKMELEDLMSDIKKTANKVRAKLKVIEQNIEQEEHTNKSSADLRIR KTQHSTLSRKFVEVMTEYNRTQTDYRERCKGRIQRQLEITGRTTTNEELEEMLEQGNPAV FTQGIIMETQQAKQTLADIEARHADIIKLENSIRELHDMFMDMAMLVESQGEMIDRIEYH VEHAVDYVQTATQDTKKALKYQSKARRAETNLLRREFYGPVNPELFAAFLDDHGLPREKV GQSDRYLSRLRGGGNVARLPARSGVGKSNYDARDGQDERLSRNLDQIGAGNLLRGASSLS AEREGSSYDGRWSRRNLDQIGGGNLLREADSRGERNLDSIGGGNLVRGANLRLDRNLDQI GGGNLMREAGKISATFLLDRARTSSWTSYPQSANGKRSNVSGSGT |
 Top
| |