| Protein: 66499475 XP_624070.1 PREDICTED: receptor expression-enhancing protein 5-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 35.6 | 33 | 31.4 | 1.133758 | 1.0509554 |
| Scape | 40 | 17.7 | 42.3 | 0.9456265 | 0.41843972 |
| Brain | 41.1 | 24.3 | 34.6 | 1.1878613 | 0.7023121 |
| Crop | 37.8 | 24.3 | 37.8 | 1 | 0.64285713 |
| Eye | 22 | 37.8 | 40.2 | 0.5472637 | 0.9402985 |
| Intestine | 26 | 37.9 | 36.1 | 0.7202216 | 1.0498616 |
| Leg, front | 34.2 | 31 | 34.8 | 0.98275864 | 0.8908046 |
| Leg, middle | 31.8 | 35.1 | 33.1 | 0.96072507 | 1.060423 |
| Leg, rear | 33.9 | 34.4 | 31.7 | 1.0694007 | 1.0851735 |
| Mandibular gland | 9.9 | 90.1 | 0.10987791 | ||
| Rectum | 6.8 | 60.9 | 32.4 | 0.20987654 | 1.8796296 |
| Salivary gland, cerebral | 30.3 | 60.1* | 9.7 | 3.1237113 | 6.195876 |
| Salivary gland, thoracic | 49.7 | 15.2 | 35.1 | 1.4159545 | 0.43304843 |
| Sternite | 8.9 | 27.9 | 63.2 | 0.14082278 | 0.4414557 |
| Tergite | 58.5 | 41.5 | 1.4096385 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 30.1 | 14.3 | 55.7 | 0.54039496 | 0.2567325 |
| Malpighian tubules | 45.3 | 17 | 37.7 | 1.2015915 | 0.4509284 |
| Nerve chord | 20.7 | 51.3 | 28.1 | 0.7366548 | 1.8256228 |
| Poison sac | |||||
| Sting | 41.5 | 58.5 | 0.7094017 | ||
| Heart | 8.8 | 56.7 | 34.5 | 0.25507247 | 1.6434783 |
| Hypopharyngeal gland | 48.8 | 51.2 | 0.953125 | ||
| Galea | 48.3 | 21.8 | 29.9 | 1.6153846 | 0.729097 |
| Glossa | 44.9 | 17.7 | 37.3 | 1.2037534 | 0.47453085 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 31.6 | 33.7 | 40.3 | 0.7841191 | 0.8362283 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MARIAAVKQSLEKALHDDNKLWTKYLAKVEKKIGVDRLYVFLSVVGFSALYLVFGIGQQL VCNIFGFVYPAYCSMKALETPKKEDDTKWLTYWVVFAVFTIVEFFSDYILCWFPVYWLFK CLFYIWLMAPIDRNGSLILYHCIIRPNFLRYHQKVDELISSAQDAAVKAATLLTEKQE |
 Top
| |