| Protein: 328778710 XP_392773.3 PREDICTED: beta-ureidopropionase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 69.2* | 19.3 | 11.5 | 6.017391 | 1.6782609 |
| Leg, front | 46 | 54 | 0.8518519 | ||
| Leg, middle | |||||
| Leg, rear | 75.4 | 24.6 | 3.0650406 | ||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 99.8* | 0.2 | 499 | ||
| Salivary gland, thoracic | 11.4* | 53.6 | 35 | 0.3257143 | 1.5314286 |
| Sternite | 12.3 | 33 | 54.7 | 0.22486289 | 0.6032907 |
| Tergite | 4.6 | 40.2 | 55.2 | 0.083333336 | 0.7282609 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 41.2 | 9 | 49.8 | 0.82730925 | 0.18072289 |
| Malpighian tubules | 37.4 | 15.1* | 47.5 | 0.7873684 | 0.31789473 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 23.9 | 76.1 | 0.31406045 | ||
| Heart | 6.8 | 21.8* | 71.4 | 0.0952381 | 0.30532214 |
| Hypopharyngeal gland | 71.6 | 28.4 | 2.5211267 | ||
| Galea | 43.5 | 56.5 | 0.7699115 | ||
| Glossa | 77.3 | 22.7 | 3.4052863 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.8 | 37.9 | 42 | 0.947619 | 0.90238094 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNNLMFDQTLEDILEKNLPEKELAEVKRLLYGRELQSLNLPQWNGSQDLDVQGYIMGGSV TEQLRPPRLVRVGLIQHSIVLPTTEPLQKQRNALHQKIQKYVDYAATCGVNILCLQEAWA MPFVFCTREKYPWCELAEDAENGPTIILMCELAQRHGMVIVCPILERDNMNSETLWNTSV VIGNDGNVLGKSRKNHIPRVGDFNESTYYMEGNTGHSVFDTCFGRIAINICYGRHHPQNW MMYGLNGAEIVFNPSATTSHTSEPLWSIEARCAAIANSYYTCAINRVGTEIFPNEFTSGD GAPAHHDFGHFYGSSYITAPDGARTPGLSRCKDGLLVCELDLNLCRQMKDLWCLRMTQRL DLYAKELNEYVEKNIKPLEKLIQ |
 Top
| |